KEGG   Desulfovibrio salexigens: Desal_2634Help
Entry
Desal_2634        CDS       T00969                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dsa  Desulfovibrio salexigens
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Desal_2634
Enzymes [BR:dsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Desal_2634
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Desal_2634
Lipid biosynthesis proteins [BR:dsa01004]
 Fatty acid synthase
  Component type
   Desal_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2882465..2883028
Genome map
AA seq 187 aa AA seqDB search
MAKITLAAFGDSLTEGYGLPAYSSLPAQLERKLLEEGFHVAINNFGLSGDTSADGLFRLA
NVIESEPNAAYIEFGANDCFQLMDPEQTKLNLSRMVETFQEANIPVLLLGFKPMNFTPQS
YSSEFSSIFNDVADKFGVPLYPSLTEGIGEAPEYYQPDGVHPNSEGVAVMVNNMFPAFKS
FLESISG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggctaagatcacattggcggcattcggggacagtttaactgaaggttacggtcttcct
gcttacagttcccttccggcacagcttgaacgcaaactgctggaagaaggcttccatgtg
gcaattaataatttcggcctgtccggggacacttccgcggacgggctatttcgccttgcc
aatgttatcgaaagcgaaccgaatgctgcgtacattgaattcggtgcaaatgactgcttt
cagctcatggaccccgagcagaccaagctcaacctgtcccgcatggtcgaaacatttcaa
gaagcaaatatcccggtcctgctgcttggcttcaagcccatgaacttcaccccgcaatcc
tattcatccgaattcagcagcatctttaatgacgttgccgacaaattcggagttcccctc
tacccgtccctgacagaaggaatcggcgaagcacctgaatattaccagcctgacggcgta
catccaaacagcgagggtgtagcagtaatggtcaacaacatgtttcctgcattcaaatct
tttctggagtccatctccgggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system