KEGG   Desulfovibrio salexigens: Desal_2791Help
Entry
Desal_2791        CDS       T00969                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dsa  Desulfovibrio salexigens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desal_2791
Enzymes [BR:dsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Desal_2791
Exosome [BR:dsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desal_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3083174..3085078)
Genome map
AA seq 634 aa AA seqDB search
MPETLPVYIAPFDLFLFGKGEHWDLYRILGAHFDLHEGQEGYRFAVWAPNAREIYVTGDF
NGWDNRANKLMPVGVSGIWAGFIPGVKPGQMYKYHVVQSDGHEVTKTDPLAFRTEMRPGH
AAVTWGLDNYEWQDEEWMSERRQTGLPLDKPVSVYEVHLGSWRREGWDYRSYRQLTEELI
PYAKDMGFTHIELMPIAEHPLDESWGYQTTHYYSPTSRHGNPDDLRYFIDQCHQAGLGVI
LDWVPGHFPKDDWGLGRFDGTSLYEHADARKGEHPDWGTYIFNFGRHEVCNFLLANALYW
LKEFHIDGLRIDAVASMLYLDYSRREGEWIPNEHGGNENIEAIELLKKLNTVVHEQFPGA
MMIAEESTSWPGVSRPVYTGGLGFTFKWNMGWMNDTLDYMEKSPIHRSYHHNNLTFSMIY
AFSENFFLPLSHDEVVHGKGALLSKMPGDMWQQMANLRLLFSYQWAHPGKNLLFMGCEFG
QWNEWNCRQELDWMLLGFPSHQGLRNTVIDLNRVMHENPAMYKHDTDWSGFEWVDFNDYK
SSTISFLRKSEGESPVLWVFNFTPVVRSGYCLGCPQDGNWEEIFNSDAEIYGGSNVGNIG
NVEARKAGDLGAFPYYLELTLPPLGAIALRPKQA
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaactttacctgtttatattgccccttttgatcttttcctgttcggcaaaggg
gaacactgggatttataccgtatactcggtgctcattttgatctgcatgaaggtcaggaa
ggttaccgttttgcggtctgggcgcccaatgcccgtgaaatttatgttaccggtgacttc
aatggctgggataaccgggccaacaaacttatgcctgtgggagtctccggcatttgggcc
ggctttattcccggcgtgaagcccggtcagatgtataaatatcatgtggttcagagtgac
ggtcatgaagtaaccaagaccgatcctttagctttccgcactgaaatgcgtcccggccat
gccgcagttacctgggggcttgataattacgaatggcaggacgaagagtggatgtccgaa
cggcgtcagaccggcttgccgttggataagcctgtctctgtttacgaggttcatctcgga
tcgtggcgcagggaaggctgggattatcgttcctaccgccagcttaccgaagagctgatt
ccttacgcaaaagatatgggtttcacccatatcgaactgatgcccattgccgagcatccc
cttgatgaatcgtggggctatcagacaacccattactattcacccacatcgcggcatggt
aatcctgatgatttgcgctacttcattgatcagtgccatcaggccggactgggcgtgatc
cttgactgggtaccgggtcattttccaaaggatgattggggtttgggtcgttttgatggc
acatctctttatgagcatgccgatgcccgtaaaggagagcacccggattggggaacctac
atttttaatttcggtcgtcatgaggtctgcaactttctgctggctaatgctctttattgg
cttaaggaatttcacatagacggactgcgcattgatgccgtggcctccatgctttatctc
gattactcccgtcgtgaaggggagtggattcccaatgagcacggcggaaatgagaatata
gaggcgattgagctgctcaagaaacttaataccgtagttcacgagcagtttcccggtgct
atgatgattgccgaggaatcaacttcatggcccggtgtgtcccgtcctgtttataccgga
ggtctaggttttacttttaaatggaacatgggctggatgaatgacactcttgattacatg
gaaaagagtcccattcaccgctcttaccatcataacaacctgaccttttccatgatctat
gctttcagcgagaactttttcctgccgctttctcatgatgaagttgtgcatggtaaaggt
gcgctgctttccaaaatgcccggtgatatgtggcagcagatggctaacctgcgtttgctc
ttcagttatcagtgggctcatccgggcaagaatctgcttttcatgggctgtgagttcggg
cagtggaatgagtggaattgccgtcaggagcttgattggatgttgctcggttttccttct
catcagggcttgcgcaacacggtcattgatttgaatcgggtcatgcatgagaatccggcc
atgtacaagcacgacactgattggtccggttttgagtgggtggactttaatgattacaag
tcatcgaccataagttttctgcgcaagagtgaaggcgagagcccagttctctgggtgttt
aacttcactccggtggtgcggtctgggtattgcctcggttgtcctcaagatgggaattgg
gaggaaattttcaattccgatgctgaaatttacggtggttccaatgtgggtaacatcggt
aatgtcgaggcccgtaaagcaggagatctgggcgctttcccctactatctggaactgact
ctgccgcctttgggagctattgctttacgaccaaagcaggcgtag

DBGET integrated database retrieval system