KEGG   Desulfovibrio salexigens: Desal_2924Help
Entry
Desal_2924        CDS       T00969                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00900  Terpenoid backbone biosynthesis
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01130  Biosynthesis of antibiotics
Module
dsa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desal_2924
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Desal_2924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACS80976
JGI: Desal_2924
UniProt: C6C0M9
Position
3239089..3239958
Genome map
AA seq 289 aa AA seqDB search
MNKTILTAPAKVNLYLKIVRKRDDGFHELDTLFHPFPALADTLEVTETGEGCTIHCADFD
LPAEDNLIYKAWDKYAEATGFRPGLHIELIKRTPTGAGLGGGSSDAASMLRFLNTHPDSP
GLEHDKLNALAAGLGADVPFFLLDGPAWAKGIGEILSPSEVDLSGLTALLACPDVHVNTA
WAYKAWSNRDRSANFKKSDAFDLTTSACGNNRTASKTRVTLFNDFEEVVLPEFPKIRETK
EYLLKNGACGAVMSGSGASIISFFKDDEAAKAAATDLKSMNVDSVLHRF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaattcttaccgccccggctaaggtcaatctctacttgaaaatcgtccgc
aaaagagatgacggctttcacgagctggacaccctctttcaccccttcccggctttggct
gacacccttgaggtgaccgaaaccggagaaggctgcactatccactgtgcggatttcgac
cttccggcggaagacaatcttatatataaagcttgggataaatatgctgaggcaaccgga
ttccgtccggggcttcacattgaattgatcaagcgcacacccacaggggccggtctcggc
ggaggcagttccgatgctgcatccatgctccgtttcctgaacactcaccccgacagtccg
gggctggaacatgataagctgaacgcactggctgcgggacttggagcggatgttcccttc
tttttactggatggtccggcatgggcaaaaggaataggtgaaattttatcgccctcagag
gttgacctttccggcctgaccgcgttattagcctgcccggatgtgcacgtgaataccgca
tgggcatataaggcatggtccaatcgtgaccggtccgctaatttcaaaaaaagtgacgcc
tttgacttgacaacgtcagcctgcggtaataatagaacggcctccaaaacgagggtgact
ttgttcaatgactttgaagaagttgtccttcccgagtttcccaaaatcagggagacaaag
gaatatctgttgaaaaacggagcctgcggagctgtcatgagcggaagcggggcaagtatc
atctctttctttaaagacgatgaagcagctaaagcagctgccactgacttgaaatcaatg
aacgttgactctgttcttcacaggttttga

DBGET integrated database retrieval system