KEGG   Desulfovibrio salexigens: Desal_3010Help
Entry
Desal_3010        CDS       T00969                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desal_3010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desal_3010
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desal_3010
Enzymes [BR:dsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desal_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3338238..3339449
Genome map
AA seq 403 aa AA seqDB search
MTDNATINADGFFGEYGGQYVPEQLLPILNELAETYEKFRKDPEFIREFQYYLAKYSGRP
TPLYLCSNLTEELGGAKIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKIIAETGAGQH
GVATAATCALMGMKCTIVMGEVDMERQKLNVFRMRMMGADVVAAKSGQKTLKEAVDEALA
AWIGDAENTFYLLGSAVGPHPYPMMVRDFQSVISKEAKQQCLEDEGRLPDYCIACVGGGS
NAIGMFAEFIADESVKLIGVEPSGRGLEPGDHAATLCLGEPGVMHGFNSYMLKDEKGEPA
PVYSISAGLDYPSVGPEHSHLKDLGRAEYVHASDKEATDAFFKLSQTEGIIPALESSHAL
AYALKLAPQLDKDKIIIVNLSGRGDKDVAQIEDMISNGELTLP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacgcaactatcaatgcagacggcttttttggtgaatacggcggacagtat
gttcccgaacagcttcttcctatcctgaacgagctggcggaaacatatgaaaaatttaga
aaagatcctgaattcatcagagaatttcagtactatctggcaaaatactccggccgcccc
actcccctctatctctgctccaacctcaccgaagaactcggcggtgctaagatctatctc
aagcgcgaagacctcaaccatctcggcgcccacaaagtaaacaacaccatcggccagatc
ctgctggcaaaacgtatgggtaagaaaaaaatcatcgctgaaaccggagccggacagcac
ggtgtagctactgccgcaacctgcgcgctcatgggtatgaaatgtaccatcgtcatgggc
gaagtggacatggaacgccagaaactgaacgttttccgtatgcgtatgatgggtgcggat
gttgttgctgcaaaatccggacagaagactctcaaagaagcagtagacgaagcgcttgcc
gcatggatcggtgatgctgaaaacactttttacctgctcggttccgcggttggaccccac
ccctacccgatgatggtccgcgacttccagtccgtgatcagtaaagaagccaaacagcag
tgccttgaagacgaaggccgtctgcctgattactgcatcgcctgtgtgggcggcggttcc
aacgccatcggcatgttcgcagaattcattgcagatgaatccgtcaaactcatcggtgta
gaaccttcaggacgcggccttgagccgggagaccatgcagccaccctttgtcttggtgaa
cctggcgtaatgcacggcttcaactcctacatgctcaaggatgaaaaaggcgaacctgct
ccggtctactccatctccgcaggtctcgactaccccagcgtaggacccgagcattcccat
cttaaggacctcggccgcgctgaatacgtccatgcatccgacaaggaagccactgatgca
ttcttcaagctctcccagactgaaggtatcatccccgcactcgagtcctctcacgcgctg
gcctacgctctcaagctggcaccgcagctcgacaaggacaaaatcatcatcgtcaacctt
tccggtcgcggtgacaaagacgttgcccagatcgaagacatgatcagcaatggcgaactt
actttgccttaa

DBGET integrated database retrieval system