KEGG   Desulfovibrio salexigens: Desal_3010Help
Entry
Desal_3010        CDS       T00969                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dsa  Desulfovibrio salexigens
Pathway
dsa00260  Glycine, serine and threonine metabolism
dsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dsa01100  Metabolic pathways
dsa01110  Biosynthesis of secondary metabolites
dsa01130  Biosynthesis of antibiotics
dsa01230  Biosynthesis of amino acids
Module
dsa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desal_3010
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desal_3010
Enzymes [BR:dsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desal_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: ACS81062
JGI: Desal_3010
UniProt: C6C0W5
Position
3338238..3339449
Genome map
AA seq 403 aa AA seqDB search
MTDNATINADGFFGEYGGQYVPEQLLPILNELAETYEKFRKDPEFIREFQYYLAKYSGRP
TPLYLCSNLTEELGGAKIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKIIAETGAGQH
GVATAATCALMGMKCTIVMGEVDMERQKLNVFRMRMMGADVVAAKSGQKTLKEAVDEALA
AWIGDAENTFYLLGSAVGPHPYPMMVRDFQSVISKEAKQQCLEDEGRLPDYCIACVGGGS
NAIGMFAEFIADESVKLIGVEPSGRGLEPGDHAATLCLGEPGVMHGFNSYMLKDEKGEPA
PVYSISAGLDYPSVGPEHSHLKDLGRAEYVHASDKEATDAFFKLSQTEGIIPALESSHAL
AYALKLAPQLDKDKIIIVNLSGRGDKDVAQIEDMISNGELTLP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaacgcaactatcaatgcagacggcttttttggtgaatacggcggacagtat
gttcccgaacagcttcttcctatcctgaacgagctggcggaaacatatgaaaaatttaga
aaagatcctgaattcatcagagaatttcagtactatctggcaaaatactccggccgcccc
actcccctctatctctgctccaacctcaccgaagaactcggcggtgctaagatctatctc
aagcgcgaagacctcaaccatctcggcgcccacaaagtaaacaacaccatcggccagatc
ctgctggcaaaacgtatgggtaagaaaaaaatcatcgctgaaaccggagccggacagcac
ggtgtagctactgccgcaacctgcgcgctcatgggtatgaaatgtaccatcgtcatgggc
gaagtggacatggaacgccagaaactgaacgttttccgtatgcgtatgatgggtgcggat
gttgttgctgcaaaatccggacagaagactctcaaagaagcagtagacgaagcgcttgcc
gcatggatcggtgatgctgaaaacactttttacctgctcggttccgcggttggaccccac
ccctacccgatgatggtccgcgacttccagtccgtgatcagtaaagaagccaaacagcag
tgccttgaagacgaaggccgtctgcctgattactgcatcgcctgtgtgggcggcggttcc
aacgccatcggcatgttcgcagaattcattgcagatgaatccgtcaaactcatcggtgta
gaaccttcaggacgcggccttgagccgggagaccatgcagccaccctttgtcttggtgaa
cctggcgtaatgcacggcttcaactcctacatgctcaaggatgaaaaaggcgaacctgct
ccggtctactccatctccgcaggtctcgactaccccagcgtaggacccgagcattcccat
cttaaggacctcggccgcgctgaatacgtccatgcatccgacaaggaagccactgatgca
ttcttcaagctctcccagactgaaggtatcatccccgcactcgagtcctctcacgcgctg
gcctacgctctcaagctggcaccgcagctcgacaaggacaaaatcatcatcgtcaacctt
tccggtcgcggtgacaaagacgttgcccagatcgaagacatgatcagcaatggcgaactt
actttgccttaa

DBGET integrated database retrieval system