KEGG   Desulfovibrio salexigens: Desal_3054Help
Entry
Desal_3054        CDS       T00969                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Desal_3054
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desal_3054
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Desal_3054
Enzymes [BR:dsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Desal_3054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3399195..3399962)
Genome map
AA seq 255 aa AA seqDB search
MSITKLADKINEAKAEGRLGLIPFLPGGYPNRDQFWKEILELDEHGADVIEIGMPFSDPV
ADGPVVEAASLKCLEDGINLKWILAGLSEHRAKISAGVLLMGYYNPVLQYGLEEFAKDAS
AAGVNGLIIADLPYEEGVEFRDLLAKYDIALIPLVGLNTEADRMALYSKGGNGFCYYVSV
LGTTGGTATLPEEIKQGLAKAQEVFDIPVALGFGLKEPSQLKELEGLVDAAVFGSALIKH
IDSGKSSAEFMKVWK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaccaaacttgcagataaaattaatgaggctaaagcagaaggccgcctcggt
ctgattccgttcctgcccggtggatatcccaaccgtgatcagttctggaaagaaattctc
gagcttgatgagcacggtgcggatgtaatcgaaatcggtatgcctttttccgatcccgtg
gcagatggtccggtggttgaggcagcttccctgaaatgccttgaggacggcatcaacctg
aagtggattctggctggactttccgaacatcgcgccaagatcagtgccggagtgctgctc
atggggtactataacccggtgctgcaatatggactggaggaatttgccaaggatgccagt
gcagccggggtaaacggtctgatcattgccgacctgccttatgaggaaggtgtggagttc
cgcgatttacttgcaaagtatgacatcgcgctgattccgctggtcggcctgaataccgag
gcggatcgcatggctctctattccaagggcggtaacggcttctgctattatgtttccgtt
ctgggaactaccggaggcaccgctacgttgcctgaagaaatcaagcagggcctcgccaag
gcgcaggaggtctttgatattccggtggctctcggtttcggactgaaagaaccttcccag
ctcaaggagcttgaaggacttgtcgatgctgctgtattcggttccgcgctgatcaagcac
attgattctgggaaaagcagtgcagagtttatgaaggtctggaaataa

DBGET integrated database retrieval system