KEGG   Desulfovibrio salexigens: Desal_3151Help
Entry
Desal_3151        CDS       T00969                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dsa  Desulfovibrio salexigens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Desal_3151
Enzymes [BR:dsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Desal_3151
Exosome [BR:dsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desal_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3509105..3510592)
Genome map
AA seq 495 aa AA seqDB search
MEKKYVLSIDQGTTSSRAIIFDKAGQIQKVTQKEFTQIFPNPGWVEHDAMEIWSSVQSVV
AEALADVPAAEIAAIGITNQRETTVVWDKNTGKPVYNAIVWQSRQTMDICNELKEKGLDP
IVREKTGLLIDAYFSGTKVKWILDNVEGAREKAEAGDLLFGTIDTWLVWKLTGGAVHVTD
YTNASRTLMYNIHELKWDEEILEALTVPASMLPEVKPSSEVYGNTHKDKFQGMEIPISGM
AGDQQAALFGQACFEEGMAKNTYGTGCFMLMNTGEKAVPSKNGLLTTIAWGVDGKVEYAL
EGSIFVAGSAVQWLRDGMRMFRDAKDSELYATRVQSSEGVYMVPAFVGLGAPYWDSEVRG
AMFGLTRGTTKEHFVRATLESLCYQTKDVLSAMEADSGIELAKLRVDGGAVANDLLLQIQ
SDFLGVPVERPMCIETTALGAAYLAGLAVGFWADKNDIKKNFGIDREFDPKMEETEAAKL
YEGWQKAVEATMAFK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaatacgtactttcaattgaccagggtactaccagctctcgcgcaatcatt
ttcgacaaagctggacagattcaaaaagttacccagaaagaattcacccagatttttccc
aatccgggttgggttgaacacgacgctatggaaatctggtcttctgtccagtccgtagtt
gctgaagccctcgccgacgttcctgctgcagaaatcgcagctatcggtatcaccaaccag
cgtgaaaccactgttgtttgggacaagaataccggtaagcccgtttacaacgcaatcgta
tggcagtcccgtcagaccatggacatctgcaacgaacttaaagaaaaaggtcttgatcct
atcgttcgtgaaaaaaccggtctgcttattgatgcatacttctccggcaccaaagtaaaa
tggatcctcgacaacgttgaaggtgctcgcgaaaaagctgaagctggcgacctcctcttc
ggtaccattgatacctggctggtttggaagctcaccggcggcgcagttcacgtaactgac
tacaccaacgcttcccgtactctcatgtacaacatccacgagctcaagtgggacgaagaa
attctcgaagctcttactgttcccgcttccatgcttcccgaagttaagccttcctctgaa
gtatacggcaatacccacaaagataagttccagggcatggaaatccccatttccggtatg
gccggtgaccagcaggctgctctgttcggtcaggcttgctttgaagaaggtatggctaaa
aacacctacggtaccggttgcttcatgctcatgaacaccggtgaaaaagcagttccttcc
aagaacggcctgctgaccaccatcgcatggggtgttgacggtaaagttgaatacgctctt
gaaggttccatcttcgtagcaggttccgctgttcagtggctgcgcgacggtatgagaatg
ttccgtgacgctaaagattccgaactctacgcaactcgcgtacagagctccgaaggcgtt
tacatggttcccgcattcgtaggtctcggtgctccttactgggattccgaagttcgcggt
gcaatgttcggtctgacccgcggtaccactaaagaacattttgttcgtgctaccctcgag
tccctctgctaccagaccaaagacgttctttccgcaatggaagctgactccggtatcgag
ctggcaaaactccgtgttgacggcggcgcagtagctaacgacctgctgctccagatccag
tccgacttcctcggtgttcctgttgagcgccccatgtgcatcgaaaccaccgctctcggt
gctgcttacctcgcaggtctggcagttggtttctgggcagacaaaaacgacatcaaaaag
aacttcggtatcgaccgtgagttcgatcctaaaatggaagaaacagaagctgcaaagctg
tacgaaggctggcagaaagctgttgaagctaccatggctttcaaatag

DBGET integrated database retrieval system