KEGG   Desulfovibrio salexigens: Desal_3603Help
Entry
Desal_3603        CDS       T00969                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dsa  Desulfovibrio salexigens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desal_3603
Enzymes [BR:dsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Desal_3603
Peptidases [BR:dsa01002]
 Cysteine Peptidases
  Family C44
   Desal_3603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4026324..4028288
Genome map
AA seq 654 aa AA seqDB search
MCGIAGFIDLNRSSDAKRLERIARKMGDAQNMRGPDGSGQWSDPEWGVGLDHRRLAIIDL
TEEGVQPMHSKSGRYVTVYNGEIYNYRDLRAELEQSEGFPGWRGHSDTEVMLEAVEQWGF
EEALKRFSGMFAIAIWDRKEHYLLLARDRMGEKPLYYSMQGGNFLFGSELKALMGYKKYF
NREVDRDSLAAYLRYCYVPGPRTIFKDTFSLMPGTWTCLRPDGELTEPRPYWSLLDCARE
AENKIFTAPDEAIVDTLEDLLLKVIEREMISDVPLGAFLSGGVDSSLIVALMQQCALAPV
KTFTIGFDDEAYNEAKDAKAVAKHIGTEHTELYVSPQDALDIIPQIPQIWDQPFSDSSQI
PTHLVSRMTREHVTVSLSGDGGDELFAGYNRHVRGCSLWHKLENVPAPLRKIGARMISNI
SPQSWNKVFKMYGPFLPPALQMRLPGQKLHKLADVMGASSASDYYRDLTSIWLNPEAVVR
NATEFRGPFQQPNSQPPQDNLTAWMQFMDAANYMVDDILTKVDRAAMGISLETRAPFLDH
EIVEFSQRLPMHLRINNGQGKHILREILYKYVPQEMIERPKMGFGVPIDSWLRGPLRGWA
EELLAPDRLDREGYFNTGHVRLAWNEHMTGIKDNQYKIWSVLMFQSWCEKWEIR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcgcaggttttattgatcttaaccgttcatctgatgcgaaacgcttggag
cgtattgcccgtaaaatgggtgatgctcagaacatgcgcggcccggacggttccgggcaa
tggtccgacccggaatggggtgtaggccttgatcaccgccgccttgctatcattgacctg
accgaagaaggcgtgcagcccatgcactccaaatcaggccgctatgtcaccgtctacaac
ggcgaaatctacaattaccgcgacttgcgtgcagaacttgaacaatccgaaggatttccg
ggctggcgcggccattctgataccgaggtcatgcttgaggctgttgagcaatggggcttt
gaagaagccctgaaaagattcagcggcatgttcgccattgccatctgggaccgcaaagaa
cactacctgctgcttgcccgcgaccgcatgggtgaaaaaccgctctactattccatgcag
ggtggcaatttcctattcggctcagagcttaaagcactcatgggctataaaaaatatttc
aaccgcgaagtagaccgcgactcactggccgcttacctgcgctattgctacgttcccggc
ccgcgcacgatatttaaagatactttttccctgatgcccggaacatggacctgtttacgt
ccagacggggaactcacggaaccccggccttactggtccctgctggactgcgcccgcgaa
gccgagaacaaaattttcaccgccccggacgaagcaattgtcgacacactggaagacctg
ctactcaaagtaattgaacgggaaatgatctccgatgtacctttaggagctttcctttca
ggcggggtagattcctcgctgatcgtagccctgatgcagcagtgcgctctggctccagtc
aaaaccttcaccatcggctttgatgatgaagcatacaatgaagcgaaagatgccaaggcc
gtagccaagcatataggtaccgaacacaccgaactgtacgtttctccgcaagacgcactg
gatataatcccccagattcctcaaatctgggaccagcctttttccgattcctcgcagatt
cctacccaccttgtctcgcgcatgacccgagaacacgtgaccgtgtccctgtccggagat
ggcggagatgaacttttcgcaggctacaaccgccacgtcagaggctgctcactatggcac
aagctggagaatgttcccgcgcctctgcgtaaaattggcgcaaggatgatttccaatatt
tcgccacagagctggaacaaagtattcaagatgtacggtccgtttctgccgccagcctta
cagatgcgcctccccggtcaaaaactgcataagcttgccgatgtgatgggggcttcatcc
gcatctgattactaccgggacctaacctccatctggctcaatccagaggccgtagtacgc
aatgcaacagaattccggggcccgttccagcagcccaactcacagcctccgcaggataat
ctgacagcatggatgcaattcatggatgcggccaactacatggtcgatgacatcctgacc
aaagttgaccgggcagctatgggcatcagcctagagacccgtgcaccatttctagatcac
gaaatcgtagaattttcccagcgtctgcctatgcatctgcgtatcaacaatggacagggc
aaacatattttacgcgaaattttgtataaatacgtgccgcaggaaatgatcgaacgtccg
aaaatgggcttcggcgttcccatagacagctggctgcgcggaccgttacgcggatgggcc
gaagaattgctggccccggacagattggatcgagaaggatattttaataccggtcatgtg
cgcctcgcttggaacgaacacatgaccggcataaaagataaccagtacaaaatctggagt
gtgctcatgtttcagagctggtgtgagaagtgggagatacgataa

DBGET integrated database retrieval system