KEGG   Desulfovibrio salexigens: Desal_3698Help
Entry
Desal_3698        CDS       T00969                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
dsa  Desulfovibrio salexigens
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:dsa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desal_3698
Enzymes [BR:dsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Desal_3698
Two-component system [BR:dsa02022]
 CheA family
  WspE-WspRF [MD:M00509]
   Desal_3698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4144036..4145049)
Genome map
AA seq 337 aa AA seqDB search
MRIGIVNDQASAVDILKKVIVDAGHEVAWIAHNGERAVEKCCADVPDLVFMDLVMPVLDG
AGATQEIMQKCPCPVLIVTTSIEDNSTKVFEAMGAGALDVVSTPRQENGSITGGKELLAK
ISVIGKLHGSKHVRAASKSAPKVRMVPPLLAIGSSTGGPSALATLLGALPEDFPAAIAIA
QHVDGNFSENLAQWLDSQTGLKVELARSGMPMQAGKVVIAPGDRHMRMGPGGIVELSRGP
GENIYVPSVDVLFESLCCAGFPSNSAAVLLTGMGADGARGMFDLRNSGWMTVAQDKESSV
VWGMPGAAVKMGAAREVCSIEDMAGLLVRHFKKRFRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagaataggtattgtgaatgatcaggcatcagccgttgatatccttaaaaaagtgatt
gtcgatgccggacatgaagttgcatggatagcccataatggagaaagggctgttgaaaag
tgctgcgccgatgtccccgatctggtttttatggatctggttatgcccgtgttggatgga
gccggagcaacacaggagattatgcagaaatgcccttgtccggttttgattgttacaacc
agcattgaagataattccaccaaggtttttgaagccatgggagctggcgcgctcgatgtt
gtttccactccccgtcaggaaaacggatctattacaggcggaaaagagcttctcgccaaa
atttcagtaatcggcaagctgcacggtagtaagcatgtgagggcggcttccaagtcggca
ccgaaagtgaggatggttccacctctgctggcaataggcagttccaccggaggaccgtct
gctttggcgactctgcttggggctttgcctgaagattttccggcagccatagccattgcc
cagcatgttgacggtaatttttccgaaaatcttgctcaatggctggatagccagaccggg
ttgaaggttgagcttgcccgcagcggcatgcctatgcaggccggaaaggtggtaatcgca
cccggcgaccggcatatgcgtatggggccggggggcattgtggaattgtcccgagggccc
ggtgaaaatatttacgtgccttctgttgatgtcctttttgaaagtctttgctgtgcagga
tttccgtccaattcagcggcggtattgctcacaggtatgggggctgatggggctcgtggt
atgttcgatctacggaattccgggtggatgactgtggcgcaggacaaggaatcaagtgtt
gtctggggcatgcccggtgcggcagtgaagatgggggcggcaagagaagtctgttccatt
gaggatatggccggtttgctggtaaggcatttcaaaaaacgtttcaggagttag

DBGET integrated database retrieval system