KEGG   Drosophila sechellia: Dsec_GM10089Help
Entry
Dsec_GM10089      CDS       T01064                                 

Definition
(RefSeq) GM10089 gene product from transcript GM10089-RA
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 681 aa AA seqDB search
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLASS
KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS
QLNTLVPRLKVPFIDKLGSSQTHLGEGEHHKGVAKFASHNVLESAYAQEILQEHYTNICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVKKYLQTCVSHLMQILRGKEKDRTVAYI
TIGYIAVAVQSAIEVHLSSIMTSVKVALPAKDLTSKRKVPVDPAVFACITLLAHAVKSEI
ADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAVLPYT
ALPTIAIDGSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADFFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFD
GKLAQPESLNSLFYYVARRNL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgacgtcggtggtgcagcagttcgtcaacgggcttaagtcccgcaaccggaat
gtccagaacaaggccacccaggatctgctcttctatgtaaagaccgagctacgcgagatg
tcccaggaggagctggcgcaattcttcgacgagttcgatcaccacattttcacgatggtg
aatgcgacggacatcaatgagaagaaaggcggtgccttggccatgaagtgcctgattaac
tgcgagggcagtctaactgccaggaaaggcatttcgccctatctcaaccgcctgcgcgat
cttctgctgatcaacgatgtgtccgtcatggagattgccgcccgctccctggtcaagttg
gccaacatgcccacctccaagggcgccgattccttcgactttgatattaagaaggctttt
gaggtgctcagaggcgagagacaagagtaccgccgccattcagccgtctttatcctccgt
gagctggcgatcgccctgccgacatacttctaccagcacatcttgaccttcttcgaggtt
atctttaacgccatcttcgatcccaaacctgctatacgagagtcagctggcgaggctttg
agggcggctttgattgtcaccgctcagcgagagagcaccaaacagtccagtgaaccacag
tggtatagaatctgctatgacgaggcgaatgggagcttcaatgcagacttggcctctagc
aaggatcagaagggcgtgacccgagatgatcgcattcacggtggcctcgtcgtcttcaac
gagctctttcgctgtgccaatgccacctgggagcggcgctacacgtcgctgaagacgctg
ttccccaagacccaacacaacaagttcctggaggccagcagttcgtcgagtatgggttcc
cagctgaatactctagtgccgcggctaaaggtgcccttcatagacaagctcggcagctcc
caaacgcatttgggcgagggagagcatcacaaaggagttgccaagttcgcgagccacaac
gtactggagtccgcctatgctcaggagatccttcaggagcactacaccaatatttgcgac
aatgtcttggagcagcgaacttcgaagtctccttatgtacagcaggcactccttcaaatt
ctgccccgattggctgcttttaaccgtgcggtgtttgtgaaaaaataccttcagacatgt
gtgtcgcacttaatgcagattctgcggggcaaggagaaggatcgcacggtggcctacatt
accattgggtacatagctgtggcggtgcagagtgcgatcgaagttcatctatccagtata
atgaccagcgtgaaagtcgctttgccggcaaaggatttgaccagcaaacgaaaggtacca
gtggatcctgcggtctttgcctgcataacgctccttgcgcatgccgttaagtcggagatc
gccgacgatgttaaggatatccttgagcagatgttctacacgggtctctcgccagctctg
actgtttgcctaagagaactctccgagaatgtgccgcagctaaagtcggccattacagaa
ggattgatcggaatcctatcccaggtgctgatgaacaaggcggctgttttaccatacact
gctttgccaacgatcgccatcgatggctcgctaatgcagaatggtgacggagccaccaca
gtgctagcactcaaaacgctgggtaccttcaactttgaggagcaaaacatgctggacttt
gtgcaacgatgcgctgacttcttcatcgttcacgagcagcaggagattcgtttggaggca
gtgcaaacatgcacacgactccttaaattggcagtgcaatcctctgaaagtatggagaac
tccaagaccctcagcgacaccgtttcccatgtgattgagcgcttgcttatggtggccatt
actgatatggactgtaatgtgcgaatacgtattctacgttcgctggacgagacctttgat
gggaaacttgctcagccagagtctctaaattcactattttattacgttgcacgacgaaat
ctttga

DBGET integrated database retrieval system