KEGG   Drosophila sechellia: Dsec_GM10100Help
Entry
Dsec_GM10100      CDS       T01064                                 

Definition
GM10100 gene product from transcript GM10100-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dse  Drosophila sechellia
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsec_GM10100
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dsec_GM10100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 503 aa AA seqDB search
MFEILEPLHAMLERGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYH
VFQKISRQLPQLTSLELPYVSPKLTTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSK
QRPRKLCIRGSNGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYA
VIPLSTNSGLIGWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEV
FEHALGQTQGDDLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLML
DRMSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLV
LRRNKDSLMAVLEAFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVED
SLPMAKSKPYDPTLQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVE
LLIQQATNNENLCQCYIGWCPFW
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagattttggagccactgcatgctatgctggagaggggaccgcaaacgctcaag
gagacatccttctcgcaggcctatggacgcgagctgacggaggcgtacgagtggtcgcag
cggtacaagacatcggcggtggtgatggatctggatcgagcgtgggacatctactatcac
gtcttccaaaagatctcgcgccagctgccacagcttacctctctggagctgccgtatgtc
tcgcccaaactgacgacgtgcaaagatctcgaactggccgtgcccgggtcctacaatcct
ggccaggagctcatccgtattagtatcattaaaaccaacctacaggtgattacttccaag
cagcgcccgcgaaaactgtgcatacgcggctccaatggcaaggactatatgtaccttcta
aagggacacgaggatcttcgtcaggacgaacgcgtgatgcagctattctccctggtgaac
acattgctgttggatgaccccgacactttccgtcgtaacttggccatccagcggtatgcg
gttatcccgctcagtaccaactcgggtcttattggttgggtgccacattgtgacaccctg
catacgctaatccgcgactaccgcgacaagaagaaggtgccactaaatcaggagcatcgc
acaatgcttaattttgcgccagactatgatcacctcacgctgatgcagaaggtggaagta
ttcgagcatgcgttgggtcagacgcaaggcgacgacttggccaagctgctgtggctcaag
tctccgtcctccgaattgtggtttgagcggagaaacaactacacccgctcactggcagtc
atgtcaatggttggatatatcctgggtctgggcgatcgtcatccatcgaaccttatgttg
gatcgtatgagcggcaagatactgcacatagactttggcgactgcttcgaggtggccatg
acgcgcgaaaagtttcccgaaaagatacccttccgtctcacccggatgctaatcaaggcg
atggaggtcacgggcatcgagggcacctacagacgcacctgcgaaagcgtgatgctggtg
cttcgccgcaacaaggattccctgatggcggtgctggaggcctttgtctacgatccactg
ctcaactggagactgttggatgttgacaagaagggcaacgatgcggtggctggggcgggt
gctccaggtggacgtggcggttccggaatgcaagacagtctcagtaactccgtggaggac
tccctgcccatggccaagtcgaagccatacgatccgacgctgcagcaaggcggcctgcac
aacaacgtggccgacgagacgaacagcaaagccagccaggtaatcaagcgggtcaagtgc
aagctaacaggcaccgacttccagacggaaaagagcgtaaacgagcagtcgcaggtggag
ctgctcatccagcaggcgaccaataacgagaacctttgccagtgctacattggctggtgt
ccgttttggtag

DBGET integrated database retrieval system