KEGG   Drosophila sechellia: Dsec_GM10237Help
Entry
Dsec_GM10237      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM10237-PA
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 437 aa AA seqDB search
MMMRMRNRGGERWQTNYFDTQMPLLSSGLMSPGQLPILDEQHGRQEQLERHYLAHGPSSV
EQQLLRLQPDYKLLYSAEHHTYFHLHTLVQKDNANRQTGPSKSEKASPHRRLFQQVVGNT
LTAAFGLNVMNKGDQEQDQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANM
YNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRF
EDLQLVGFSMGAHVAGLAGKYLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVL
HTSVGSYGFDRPVGHADFYANWGSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQGC
PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFETNDQPPYVLAQNAS
SKRAAHIQINSEMAERT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcggatgagaaatcggggcggtgagcggtggcagacgaactactttgacaca
caaatgccactgctgtcgtctggcctaatgagtcccggccagctgccaatattggatgag
cagcatgggcggcaggagcagttggagaggcattacttggcccacgggcccagttcggtt
gaacagcaattactccgcctgcagccggactacaaattgctgtacagcgccgagcaccac
acctacttccacctgcacaccctggtccagaaggacaatgccaaccgccagacaggacca
tcgaaatccgagaaggcatcgccacatcgccggctattccagcaggtggtgggcaacacg
ctaaccgccgccttcggcctgaacgtgatgaacaagggggaccaggaacaggaccagcag
ttcaccagcgaaccggttaatctctacgatgccgcctcgttgcgacggtctcgcttcagt
cctttcaatcccaccagaatcctcattcacggctggttgggcaatgaaaatgccaacatg
tacaacgagctattgccagcttactttgatctgagaaatggcaactacaacatcttcacc
gtggactggggacgtggagccatagcggactatataacggccagctatagggtcaagccg
gtgggtcaggttttggccaaattcgtggacttcctgcatcaggaggcgggaatgcgtttc
gaggatctccagctcgtcggattcagcatgggcgcacatgtggcgggactggcaggcaaa
tatttgcagaccggtcgccttcggatgatccgagctttggatccggctctacccttcttc
cggtatgccaagccaaaggagcgcctgaccgccgaggatgccgactatgtggaggtgctg
cacaccagtgtgggcagctatggatttgatcgacccgtgggtcatgcggatttctatgcc
aactggggcagccagcaaccaggttgcttttggcatgaatgcagccattggagggcattt
atgctgttcgccgagagtctggcaagggatcaggcaacgggcttcttatcccagggctgt
ccagctgctgaatggcagcagttgacccgattccatcgctgcccaaaggacaccggagtt
atgcagaccatgggcggggatttggccaacgtgtcggcggagttcttggcccaaagacag
ggtgtctattatttcgaaacaaacgaccagccaccctatgttttagcacaaaacgccagc
tcgaaaagggcggcacacatacaaataaatagcgaaatggctgagagaacgtaa

DBGET integrated database retrieval system