KEGG   Drosophila sechellia: Dsec_GM10237Help
Entry
Dsec_GM10237      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM10237-PA
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6 DUF4696 Lipase_3
Motif
Other DBs
NCBI-GeneID: 6616937
NCBI-ProteinID: XP_002041267
FlyBase: FBgn0165188
UniProt: B4ICA9
AA seq 437 aa AA seqDB search
MMMRMRNRGGERWQTNYFDTQMPLLSSGLMSPGQLPILDEQHGRQEQLERHYLAHGPSSV
EQQLLRLQPDYKLLYSAEHHTYFHLHTLVQKDNANRQTGPSKSEKASPHRRLFQQVVGNT
LTAAFGLNVMNKGDQEQDQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANM
YNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRF
EDLQLVGFSMGAHVAGLAGKYLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVL
HTSVGSYGFDRPVGHADFYANWGSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQGC
PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFETNDQPPYVLAQNAS
SKRAAHIQINSEMAERT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcggatgagaaatcggggcggtgagcggtggcagacgaactactttgacaca
caaatgccactgctgtcgtctggcctaatgagtcccggccagctgccaatattggatgag
cagcatgggcggcaggagcagttggagaggcattacttggcccacgggcccagttcggtt
gaacagcaattactccgcctgcagccggactacaaattgctgtacagcgccgagcaccac
acctacttccacctgcacaccctggtccagaaggacaatgccaaccgccagacaggacca
tcgaaatccgagaaggcatcgccacatcgccggctattccagcaggtggtgggcaacacg
ctaaccgccgccttcggcctgaacgtgatgaacaagggggaccaggaacaggaccagcag
ttcaccagcgaaccggttaatctctacgatgccgcctcgttgcgacggtctcgcttcagt
cctttcaatcccaccagaatcctcattcacggctggttgggcaatgaaaatgccaacatg
tacaacgagctattgccagcttactttgatctgagaaatggcaactacaacatcttcacc
gtggactggggacgtggagccatagcggactatataacggccagctatagggtcaagccg
gtgggtcaggttttggccaaattcgtggacttcctgcatcaggaggcgggaatgcgtttc
gaggatctccagctcgtcggattcagcatgggcgcacatgtggcgggactggcaggcaaa
tatttgcagaccggtcgccttcggatgatccgagctttggatccggctctacccttcttc
cggtatgccaagccaaaggagcgcctgaccgccgaggatgccgactatgtggaggtgctg
cacaccagtgtgggcagctatggatttgatcgacccgtgggtcatgcggatttctatgcc
aactggggcagccagcaaccaggttgcttttggcatgaatgcagccattggagggcattt
atgctgttcgccgagagtctggcaagggatcaggcaacgggcttcttatcccagggctgt
ccagctgctgaatggcagcagttgacccgattccatcgctgcccaaaggacaccggagtt
atgcagaccatgggcggggatttggccaacgtgtcggcggagttcttggcccaaagacag
ggtgtctattatttcgaaacaaacgaccagccaccctatgttttagcacaaaacgccagc
tcgaaaagggcggcacacatacaaataaatagcgaaatggctgagagaacgtaa

DBGET integrated database retrieval system