KEGG   Drosophila sechellia: Dsec_GM10237Help
Entry
Dsec_GM10237      CDS       T01064                                 

Definition
GM10237 gene product from transcript GM10237-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dse  Drosophila sechellia
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dsec_GM10237
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dsec_GM10237
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dsec_GM10237
  Exosomal proteins of breast milk
   Dsec_GM10237
Heparan sulfate/heparin binding proteins [BR:dse00536]
 Enzymes (General comment) Variety
  Dsec_GM10237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 437 aa AA seqDB search
MMMRMRNRGGERWQTNYFDTQMPLLSSGLMSPGQLPILDEQHGRQEQLERHYLAHGPSSV
EQQLLRLQPDYKLLYSAEHHTYFHLHTLVQKDNANRQTGPSKSEKASPHRRLFQQVVGNT
LTAAFGLNVMNKGDQEQDQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANM
YNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRF
EDLQLVGFSMGAHVAGLAGKYLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVL
HTSVGSYGFDRPVGHADFYANWGSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQGC
PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFETNDQPPYVLAQNAS
SKRAAHIQINSEMAERT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcggatgagaaatcggggcggtgagcggtggcagacgaactactttgacaca
caaatgccactgctgtcgtctggcctaatgagtcccggccagctgccaatattggatgag
cagcatgggcggcaggagcagttggagaggcattacttggcccacgggcccagttcggtt
gaacagcaattactccgcctgcagccggactacaaattgctgtacagcgccgagcaccac
acctacttccacctgcacaccctggtccagaaggacaatgccaaccgccagacaggacca
tcgaaatccgagaaggcatcgccacatcgccggctattccagcaggtggtgggcaacacg
ctaaccgccgccttcggcctgaacgtgatgaacaagggggaccaggaacaggaccagcag
ttcaccagcgaaccggttaatctctacgatgccgcctcgttgcgacggtctcgcttcagt
cctttcaatcccaccagaatcctcattcacggctggttgggcaatgaaaatgccaacatg
tacaacgagctattgccagcttactttgatctgagaaatggcaactacaacatcttcacc
gtggactggggacgtggagccatagcggactatataacggccagctatagggtcaagccg
gtgggtcaggttttggccaaattcgtggacttcctgcatcaggaggcgggaatgcgtttc
gaggatctccagctcgtcggattcagcatgggcgcacatgtggcgggactggcaggcaaa
tatttgcagaccggtcgccttcggatgatccgagctttggatccggctctacccttcttc
cggtatgccaagccaaaggagcgcctgaccgccgaggatgccgactatgtggaggtgctg
cacaccagtgtgggcagctatggatttgatcgacccgtgggtcatgcggatttctatgcc
aactggggcagccagcaaccaggttgcttttggcatgaatgcagccattggagggcattt
atgctgttcgccgagagtctggcaagggatcaggcaacgggcttcttatcccagggctgt
ccagctgctgaatggcagcagttgacccgattccatcgctgcccaaaggacaccggagtt
atgcagaccatgggcggggatttggccaacgtgtcggcggagttcttggcccaaagacag
ggtgtctattatttcgaaacaaacgaccagccaccctatgttttagcacaaaacgccagc
tcgaaaagggcggcacacatacaaataaatagcgaaatggctgagagaacgtaa

DBGET integrated database retrieval system