KEGG   Drosophila sechellia: Dsec_GM10590Help
Entry
Dsec_GM10590      CDS       T01064                                 

Definition
GM10590 gene product from transcript GM10590-RA
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsec_GM10590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 404 aa AA seqDB search
MAQIEKYQDFVIDALEVVDFKLIRDKADINNDALTFHPAMAHQIFGETETIFGYQDLHVR
VMYTAGPLHIYLGVDYGKRVNEISGGEIKADDVVSTIAQSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKISEYRRVSDDGSERLFEIYQCDYKSSSFLKFFARLQTFILWFVDAASYIDT
DDPQWCYFLCYEKYKNNDCQWQYATLGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLA
TQLVESIYRFYQAQKNVVDITVEDPSEDFQRLRNFVDARSCMELKSFARGEIVKGFNKEM
VREAREALKLNPIQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKM
ERFKMDTEMLRARLPTIQQRMEQLHEEYMVVEQEYQSTIAKLRA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaatcgagaagtaccaggactttgtgattgatgctctcgaagtggtagacttt
aagctgatccgtgacaaggccgatatcaacaatgatgccctgacctttcatcccgcaatg
gcccaccagattttcggggagaccgagacgatcttcggctaccaggacttgcacgtccgt
gtaatgtacacggcaggacctttgcacatctaccttggcgtcgattacggcaaacgggtg
aatgagatctccggtggagagatcaaggccgacgacgtcgtcagcacaattgctcagagt
ctgccggacggctgctacttcatcaatcttgatgagtttctcaagacactggacaaggct
gacaaatttcagcccttcggtgagaagataagcgaatacaggcgggtatcggacgacggc
agcgagcgccttttcgagatctaccagtgcgactacaagagctcatcattcttaaagttc
tttgcccggctgcagacgttcatcttgtggttcgtggacgctgcctcctacatcgacact
gatgatccacagtggtgctacttcttgtgctacgaaaagtacaagaacaacgattgccag
tggcagtacgccactcttggttacaccaccgtatacgagtactacgcctatccgcaaaac
aagaggcccaggataagccagatgctgatactgccgcctttccagaaactcggcttggct
acccaattggtcgagagcatttacaggttttatcaggcacagaagaatgttgtggacata
acagtggaggatccgtctgaggatttccagcgtttgaggaattttgtggacgcgcgatct
tgcatggaattgaagtcgtttgcccggggcgagatagtcaagggcttcaacaaggagatg
gtgcgggaagcgcgcgaggctctgaagctcaatcccatccaggtgcgtaaagtgtatgag
ctgttgcgtttattctacaccaatgtaaaagatgaaaaggagtaccgaccctatcgcctg
gaagttaagaaacggcttaatgcggtctattacaagcagttaaaggatttgaagaaaatg
gagcgcttcaagatggacactgaaatgctgcgtgctcgcctaccaacgattcaacaacgt
atggagcagctgcatgaggaatacatggtggtcgagcaggagtaccagagcaccattgcc
aagttgagggcctga

DBGET integrated database retrieval system