KEGG   Drosophila sechellia: Dsec_GM10604Help
Entry
Dsec_GM10604      CDS       T01064                                 

Definition
GM10604 gene product from transcript GM10604-RA
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 105 aa AA seqDB search
MNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQD
QLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcctggcccactttcgcccgctgagggataacaagcagagcaagctcaacagc
cgggaggagaagctgaagttcgccttcaagatgtacgatctggatgacgatggcgtgatc
agcagagacgagctgctgtccatcctgcacatgatggtcggggcgaacattagccaggac
cagttggtcagcatcgcggagaggacgattctggaggcggacctgtgctgccagggcaag
atctcgttcgaggacttctgcaaagctctggaccgcaccgacgtagatcagaagatgtcc
atacggtttctcaactag

DBGET integrated database retrieval system