KEGG   Drosophila sechellia: Dsec_GM10604Help
Entry
Dsec_GM10604      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM10604-PA
  KO
K17610  calcineurin B homologous protein 1
Organism
dse  Drosophila sechellia
Brite
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dsec_GM10604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RE_XamI
Motif
Other DBs
NCBI-GeneID: 6614003
NCBI-ProteinID: XP_002038457
FlyBase: FBgn0165550
UniProt: B4I451
AA seq 105 aa AA seqDB search
MNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQD
QLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFLN
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcctggcccactttcgcccgctgagggataacaagcagagcaagctcaacagc
cgggaggagaagctgaagttcgccttcaagatgtacgatctggatgacgatggcgtgatc
agcagagacgagctgctgtccatcctgcacatgatggtcggggcgaacattagccaggac
cagttggtcagcatcgcggagaggacgattctggaggcggacctgtgctgccagggcaag
atctcgttcgaggacttctgcaaagctctggaccgcaccgacgtagatcagaagatgtcc
atacggtttctcaactag

DBGET integrated database retrieval system