KEGG   Drosophila sechellia: Dsec_GM10623Help
Entry
Dsec_GM10623      CDS       T01064                                 

Definition
GM10623 gene product from transcript GM10623-RA
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dsec_GM10623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 226 aa AA seqDB search
MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTIS
APHMHAFALEYLRDQLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAEL
VRLSKANLNTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLAN
GGRLIVPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPLTDLRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggcgatccgtgggagccaataatgaagacctcatacgccaactgaaggatcac
ggcgtcattgcaagtgatgcggtagcccaggcgatgaaggaaaccgaccgcaagcactac
tctccgcgcaacccctacatggacgccccgcaacccattggaggaggtgtcaccatcagt
gctcctcacatgcatgccttcgccttggagtacctacgcgaccaattgaagcccggtgca
cgcatactggacgtaggctctggatctggctacctcacagcctgcttttatcgttacatc
aaggctaagggtgttgatgcggacacccggatcgtgggcatagagcaccaggcagagctg
gtgcggctgagcaaggccaacttaaacaccgacgaccgtagcatgctggactccggccag
ttgctaatcgtcgagggtgacggccgcaagggatatcccccgaacgccccgtataatgca
atccatgtaggagcagctgctcccgacacgcccaccgaactcatcaaccaactggccaac
ggcgggcgcctgatagttccagtcggtcccgacggcgggtctcagtacatgcaacagtac
gacaaggacgccaatgggaaggtggagatgacgcgtctcatgggcgtaatgtacgtcccc
ctcacggatcttcgctcctga

DBGET integrated database retrieval system