KEGG   Drosophila sechellia: Dsec_GM10631Help
Entry
Dsec_GM10631      CDS       T01064                                 

Definition
GM10631 gene product from transcript GM10631-RA
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dsec_GM10631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 438 aa AA seqDB search
MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDML
RFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGA
QKLNHNHSDICINWSGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDVHHGD
GVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQV
FKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGG
GGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYL
ELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRNNREEASDPDVRMSVADEDKLVDAK
NEFYDGDQDQDKPDSAES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccggagggtgtcgtacttctacaatgcggacgtgggcaacttccactatgga
gccgggcatccgatgaagccgcagcgcctggcggtcactcacagcctggtgatgaactac
ggactgcacaaaaaaatgaagatctacaggccgtacaaggccagtgcgcaggacatgctc
cgcttccacagcgacgagtacatcgcctacttacagcaggtgactccacaaaacattcag
tgcaattccgtggcctatacgaagtatctggctcacttcagcgtaggcgaggactgtccc
gtattcgatggcctctttgacttctgtgcaatgtacacgggtgcctcgctggagggagcc
cagaagctgaaccacaaccatagcgacatatgcataaactggtcgggcggactgcatcac
gccaagaagttcgaggcaagcggattctgctacgtgaatgacatcgtcatcggcattctg
gagctgctaaagtaccatcctcgggtgctctacatcgacatcgatgtgcaccacggcgac
ggggtgcaggaggccttctaccttacggaccgagtgatgacggcttcgttccacaaatac
ggaaactacttctttcccggcacgggagacatgtacgagatcggcgccgaatcgggacga
tactacagcgttaatgtgccgctaaaggagggcattgatgatcagagctatttccaggtg
ttcaaacccatcatttcggccattatggacttctaccggccaacagctatcgttttgcaa
tgtggcgccgattctctggctggagatcgactgggttgcttctccctgagcaccaaggga
catggtgagtgtgtcaaatttgtgaaggaactgaacgtacccacattggtggtcggaggc
ggtggctacaccttacggaacgtggcccgctgctggacgcacgagacctcgctgctggtg
gaccaagacattgaaaatgaccttcccgccaccgagtattacgacttcttcgcccccgac
tttacactccatccagagattaactcacgccaagataatgcgaactcaaagcaatatctg
gaactcattgttaagcatgtgtacgaaaaccttaagatgtgccagcactcgcccagcgtc
caaatggtgcagaccccgcctgatgtggacttggaagagctgcgcaacaaccgggaggag
gcgagtgatcccgacgtgcgaatgtccgtggccgatgaggacaagctggtcgatgccaag
aacgagttctacgacggcgatcaggaccaagacaagcccgattcggcagaaagttag

DBGET integrated database retrieval system