KEGG   Drosophila sechellia: Dsec_GM10686Help
Entry
Dsec_GM10686      CDS       T01064                                 

Definition
GM10686 gene product from transcript GM10686-RA
Orthology
K14283  
transforming acidic coiled-coil-containing protein 3
Organism
dse  Drosophila sechellia
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dse03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1189 aa AA seqDB search
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQKAMAAALGHQT
AVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLSTDMDTQLKTNHSDSDVFVECLSLHSE
RYTGDRSELEAYSSALNDVLEQQLSMTSASTLDAAFNDPLAVSQHNNVSYEDMDVDDDLN
ETMEMLKDSLDAEDHHLMQTHILSVTQPKPENNSVHLPNQEQNRVELDQLAKHSKRNSNA
KEPPFVESVLSEESGTQLLEPELTLSALDSTKDLAKHHEEKQTDTEDVFQKEDHHPVSSA
QMEEAQNPEEPKIALNLKEASSELSTKLANNLECPYQEKQLESMERTCTAISLEQSASPA
MEATEDRNVEELDHMDVDESMRVDDAPVLNSCRQEQMHTLSPVSSKSFSKPCVENDTDFQ
NNKMDQKTAGKESPLKMTEIELPVESVPSAPLSPPIPTLQAKMMELPRSPPIPTHRPKTA
EELEFLALRELPLPDDDPTAEKVVFKQLSHGRVPVVAVSPTPLSLDLKGNTTTASLPEPT
SPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDFGAGVIAKSPIVF
QLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITEDKSQKGTENIEPSSNFAVSLGSV
DDKQRRTFSVEATEDTGADEVMDVDISMRADEVAVMNSPQQTWKERQAPISNSPPIPTHQ
HLKRPPIHEANSPVSPLGNGTVVLEEQALSAKEQATLSASDEKDDVFLEHFGAISPVSDD
MFKTSSGSNNQAKFRVNADEETGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLIL
NSSDFDYLYTKGSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEKALQNILGSNQHQNRL
LSPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKKHVKMSVDVIDNDCNKTFDN
SNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELREEALIKRITEKDKTNAKL
NGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLTSLETTFSDLHVKYEKS
KEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADE
TKKLKALLKKEEISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgacggcgcagaaaatggcctgggaatggaatttggcggtcgcggcattctg
cgggagatcaacaaaaacgatggcggcattaagctgagtccgctggcggtgaagcccagt
cccaagccgacgagcatggatcaacagaaggcaatggcggcagctctgggccatcagacg
gcggtacccggtggccgtaagctagacgacgacctcgttccaaagtttggaggtcttccc
gagttcgatgagacgcaaataccggaactggctcctttaagtaccgatatggacactcaa
ctgaaaaccaaccattcggattcggatgtttttgtcgagtgtttatcgcttcatagcgag
cgctataccggagatcgatcggagttagaggcctattcaagtgcccttaatgatgttttg
gagcagcagctgtccatgacctcagcttctacactggatgctgcattcaacgatccttta
gcggttagccagcacaacaacgtcagctatgaagacatggatgtggatgatgacctaaac
gaaaccatggaaatgttaaaggactccttggatgcggaagaccatcatcttatgcaaacg
catattctcagcgtaacccagccaaaaccagagaataattctgtgcaccttccaaatcag
gaacaaaatagggttgaactagaccagttagccaaacactctaaacgcaatagtaatgca
aaggagccaccattcgtagaatcagtattgtctgaggagtctggtacacaacttcttgag
ccggagctcaccttatctgccttggactctacgaaagacttagctaagcatcatgaggaa
aagcaaacggatacagaagatgtatttcagaaagaggaccaccatccggtcagtagtgcg
cagatggaggaggcacaaaatcctgaggaacctaaaatagccttaaatctcaaagaggct
tcttcagaactgtccacaaaactagcaaataatctagaatgcccttatcaagagaagcaa
ttagaatcaatggagagaacatgcactgccatcagccttgagcaaagtgcatccccagct
atggaggcaactgaagacagaaatgtggaggagcttgatcacatggacgtggatgaatcc
atgagagtggatgatgccccagtgcttaactcatgtcggcaggagcaaatgcatactctt
tctcccgtttcaagcaaatctttttcaaaaccctgcgttgaaaatgatacggattttcaa
aataataaaatggatcaaaaaactgcaggcaaagagagtccattgaagatgactgaaata
gagctgcctgtggaatctgtcccatcagcaccactctcaccgccgatacccacacttcaa
gcaaaaatgatggaactgccccgttctccgcccatacctacacatcgcccaaaaacagcg
gaggaactagagttcctggctctgagggagctgcccttgcccgatgatgaccccacggcg
gaaaaggtggtatttaagcagctatcacacggccgcgtacccgtggtggcagtctcccca
acgccactttccttggatctgaaaggaaatacaaccactgcaagccttccagaacccact
tcgcccagtttccccatcaaagaacctgctgaaaaacagtcccactttccacgctcaccc
cgtgctcagcccgagcaaaaggacatgccctatttggaagaggctgttgtagaacgttct
tcagatcgcaagcaaagcgatttcggtgccggagtcatagcgaaatcaccaatagtgttt
cagttaacacaacccagtcctgagaagcagcacctcaacgaaaccttgcccatgagcgaa
atttctcccactccgtcaaatatgacctttgacagcggaagcattacggaggacaaatct
cagaagggtacagagaatattgagccttcatccaacttcgccgtaagtctgggatcggtc
gatgataaacagcgccgcactttctcggtggaggccaccgaagataccggggctgatgaa
gtcatggatgtagatatctccatgagggcagatgaagtagccgtgatgaattcgcctcag
caaacttggaaggaacgccaagcaccaatttcaaattcaccacctattcctacccatcaa
catttaaaaagaccccctatccatgaggcgaattctccagtgtcaccattgggaaatggc
accgttgtgttggaggagcaggctctctctgctaaagagcaagccacgctgagcgccagc
gatgagaaggacgatgttttcttggagcactttggtgccatttctccagtttcggatgac
atgtttaaaaccagcagcggctcgaacaatcaagcaaagtttagggtcaatgctgatgaa
gaaaccggagtcaaaggcgcttctgctatgatcagaaagagaagtggtacagctggcgag
caggaagcgatcttcgatgccgaattccatgatggcgccaacaaccaaaacctgatactg
aattcatcagattttgattatttgtacacgaaaggcagcaatagtgcgcctatcgaccgc
agttcgctgctgttgaagtttgatcccctccttggagcccctgttcccgttaatcatccg
aatcagcaggagaaggcgctgcagaatattctgggatcgaaccagcaccagaaccggctt
cttagcccaacattggaggagcacgaaacaagtgacgggaaccagtcttttggattaata
tcgagtgccaaagatacagccaagaaatgggattttaagccacctgtggatagaacaaaa
aagcatgttaaaatgagtgtagacgtcattgataacgattgcaacaaaaccttcgataat
tccaacactaatacggaggataagacgcacaactacaacgatatggatgagctggagaag
aaaatcaaaaatgaagtaacgcggtccgaagacattgaaaagaagctcaaagagggagag
ttgcgcgaggaggctctgatcaagcgtattacagaaaaggacaaaacaaatgcaaaacta
aacggtgtcatcgaggcgtatgagaaagcaattgcagagcttatcagtgagaaggagcag
caggcacagcttcacgaacggcagttgcaggaagtccaggcagaccgggacgcaaattac
catcacttaacgtcgttggagacgacattttccgatctgcatgtgaaatacgagaaaagc
aaagagatgacctcgcagctcaaaagcaacgaggaatcgcttctggcagagcgaaagcag
atgatggacaatctgcggttgcaggaacagcgctacgacaagatgaagaaccatgccatg
cagcagctggaaattgccaacaaaaagcttgacacctacgcgagggagcatgccgacgag
acgaaaaaacttaaagctttacttaagaaggaggagatctcgcgggtctcgatgactgag
cagctgcaacagaaatcacgcgaaaacgctgatctgctcaagatctgcgaggagctcatc
tatggcaagggacaaggtggtagtagttaa

DBGET integrated database retrieval system