KEGG   Drosophila sechellia: Dsec_GM11120Help
Entry
Dsec_GM11120      CDS       T01064                                 

Definition
GM11120 gene product from transcript GM11120-RA
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dse  Drosophila sechellia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM11120
Translation factors [BR:dse03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dsec_GM11120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 236 aa AA seqDB search
MADDWESAADSDVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKP
KPNKALKAKLEQQALREEEAEAERLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTS
TCGGLDAFNPETKEEFKEFGATLSWKVAQFRESEHFPQFVEDLVRSLCVNLSAADIKKVK
MNVEVLHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgattgggaatccgcagcagacagcgatgtggtcatccggccgactgccgcc
gccagcgtaaacaagtgggagggcgaggacgaggatgaggacatcaaggacagctgggag
gatgaggaggaaaaaaaagacgaggagaagcccacgaaaacagaagcaccagccaaaccg
aagccaaataaggcgctaaaagccaaactggaacagcaggcgctccgagaggaggaagcg
gaggcagaacgtctggccaatctatcgcctgcagaaaagttggctgagaagctgcgattg
caaaaaatccaggaggcctctgatctcaagcatgcccaggaagcgttcggcgtgacgagt
acgtgcggagggcttgacgccttcaaccccgagaccaaggaggagttcaaggagttcggc
gcaacgctcagctggaaggtggcgcagttccgcgagtctgagcacttcccccagtttgtt
gaggatctggtgcgcagcctatgcgtgaatctaagcgccgctgacatcaaaaaggtcaag
atgaacgtggaggtcttgcactcggaaaagctgaagctggaaaaggccaatgccaaaaag
cccgctggaaagggcaagggcaaggttactctccgcaccgaaaacgacgacattgacggt
taccaaaagtacggaaatgacttcaccgaagactatgatgacttcatgtga

DBGET integrated database retrieval system