KEGG   Drosophila sechellia: Dsec_GM11221Help
Entry
Dsec_GM11221      CDS       T01064                                 

Definition
GM11221 gene product from transcript GM11221-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dse  Drosophila sechellia
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dse00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 566 aa AA seqDB search
LSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGALADADIC
FFENQNGFFNAVTDTYTSPDGQWVRRDYQQDCEVFKMDEFTLAFRRKFDTCDPLDLRLHE
GTMYVVWARGETELALEDHQFALPNVTAPHEAGVKMVQLLRADKILIPETELDHMEITLQ
EAAIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVHHMEVFHCEAGEHEEIPLY
NGDCEQLPPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPEKQS
GLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPA
TGIIIFGSQLHTHLRGVTSYPPLSRRAGTARVNAMTSTRITSRRCGPCTTSHVYWPMTRP
AALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARS
SNYRSIEWTQPRIDQLYTMYMQEPLSMQCNRSDGTRFEGRASWEGVAATPVQIRIPIHRK
LCPNYNPLWLKPLEKGECDLLGECIY
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttatccgacacaaagcttcacgagatctacctggacgacaaggagattaagctgagctgg
atggtggactggtacaagcaggaggtgcttttccacttgcagaatgcttttaacgaacaa
caccgctggttctatctggggttctccaagcgcggcgctttggcggatgcggatatttgc
ttctttgagaatcagaatgggttcttcaacgcagtaaccgatacgtacaccagtccggat
gggcagtgggtgaggcgggactaccagcaggactgtgaggtcttcaagatggatgagttc
acgctggcctttaggcgcaagttcgatacctgtgaccctttggatctgcgactccatgag
ggcacaatgtacgtggtttgggcccgtggtgaaacggagctggccctggaggatcaccag
ttcgccctgcccaatgtgacggctccgcacgaggcgggtgttaagatggtacagctgctc
cgggccgacaagatacttatacccgagaccgagctggatcacatggagatcaccctgcag
gaggcggcaattcccagccaggagaccacctactggtgtcacgttcagcgactggagggc
aatctccggcgtcgccatcacatcgtccagttcgagccgctcatccggacgccgggcatc
gtgcaccacatggaagtcttccactgcgaggccggcgagcacgaggagattcccctgtac
aacggcgactgcgaacaattgccgccacgggccaagatctgctctaaagtgatggtcctg
tgggccatgggagccggcacctttacctatcctccggaggccggcctgccaatcggtgga
cccggcttcaatccgtatgttcggctggaggttcatttcaataatccggaaaagcagtct
ggcttggtggacaactccggcttccgcatcaagatgtcaaagacactgcgtcagtatgac
gccgccgtaatggaactgggcctggagtacactgacaaaatggccattccgcctggtcaa
accgcttttccgctgagcggctactgtgtggcggactgcactcgagccgctctgccggcg
acgggcatcatcatctttggctctcagctgcatacccatctgcgtggcgtcacgtcctac
ccgccactttcgcggcgagcaggaactgcgcgagtgaacgcgatgacttctactcgaatc
acttccaggagatgcgggccttgcactaccagccacgtgtactggccgatgacaagaccc
gccgccctcggcggattctccatcagcgacgagatgtgcgtcaactacatccactactat
ccggccaccaaactggaggtctgcaagagttccgtttccgaggagacgctcgagaattac
tttatttacatgaagcgcacggagcatcagcacggcgtgcatctgaatggagccaggtcg
tccaattaccggagcatcgagtggacccagccgcggatcgatcagctgtacaccatgtac
atgcaggagccgctgagcatgcagtgcaacaggtccgatggcactcgcttcgaggggcgc
gccagctgggagggcgtggcagcgacgcccgtccaaatccgcatacccattcaccgcaaa
ctgtgccccaactacaatccgctgtggctgaagccattggagaagggcgagtgcgatttg
ctgggggagtgcatctattag

DBGET integrated database retrieval system