KEGG   Drosophila sechellia: Dsec_GM11221Help
Entry
Dsec_GM11221      CDS       T01064                                 

Definition
GM11221 gene product from transcript GM11221-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
dse  Drosophila sechellia
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dsec_GM11221
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dsec_GM11221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 566 aa AA seqDB search
LSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFYLGFSKRGALADADIC
FFENQNGFFNAVTDTYTSPDGQWVRRDYQQDCEVFKMDEFTLAFRRKFDTCDPLDLRLHE
GTMYVVWARGETELALEDHQFALPNVTAPHEAGVKMVQLLRADKILIPETELDHMEITLQ
EAAIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVHHMEVFHCEAGEHEEIPLY
NGDCEQLPPRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNPYVRLEVHFNNPEKQS
GLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPLSGYCVADCTRAALPA
TGIIIFGSQLHTHLRGVTSYPPLSRRAGTARVNAMTSTRITSRRCGPCTTSHVYWPMTRP
AALGGFSISDEMCVNYIHYYPATKLEVCKSSVSEETLENYFIYMKRTEHQHGVHLNGARS
SNYRSIEWTQPRIDQLYTMYMQEPLSMQCNRSDGTRFEGRASWEGVAATPVQIRIPIHRK
LCPNYNPLWLKPLEKGECDLLGECIY
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
ttatccgacacaaagcttcacgagatctacctggacgacaaggagattaagctgagctgg
atggtggactggtacaagcaggaggtgcttttccacttgcagaatgcttttaacgaacaa
caccgctggttctatctggggttctccaagcgcggcgctttggcggatgcggatatttgc
ttctttgagaatcagaatgggttcttcaacgcagtaaccgatacgtacaccagtccggat
gggcagtgggtgaggcgggactaccagcaggactgtgaggtcttcaagatggatgagttc
acgctggcctttaggcgcaagttcgatacctgtgaccctttggatctgcgactccatgag
ggcacaatgtacgtggtttgggcccgtggtgaaacggagctggccctggaggatcaccag
ttcgccctgcccaatgtgacggctccgcacgaggcgggtgttaagatggtacagctgctc
cgggccgacaagatacttatacccgagaccgagctggatcacatggagatcaccctgcag
gaggcggcaattcccagccaggagaccacctactggtgtcacgttcagcgactggagggc
aatctccggcgtcgccatcacatcgtccagttcgagccgctcatccggacgccgggcatc
gtgcaccacatggaagtcttccactgcgaggccggcgagcacgaggagattcccctgtac
aacggcgactgcgaacaattgccgccacgggccaagatctgctctaaagtgatggtcctg
tgggccatgggagccggcacctttacctatcctccggaggccggcctgccaatcggtgga
cccggcttcaatccgtatgttcggctggaggttcatttcaataatccggaaaagcagtct
ggcttggtggacaactccggcttccgcatcaagatgtcaaagacactgcgtcagtatgac
gccgccgtaatggaactgggcctggagtacactgacaaaatggccattccgcctggtcaa
accgcttttccgctgagcggctactgtgtggcggactgcactcgagccgctctgccggcg
acgggcatcatcatctttggctctcagctgcatacccatctgcgtggcgtcacgtcctac
ccgccactttcgcggcgagcaggaactgcgcgagtgaacgcgatgacttctactcgaatc
acttccaggagatgcgggccttgcactaccagccacgtgtactggccgatgacaagaccc
gccgccctcggcggattctccatcagcgacgagatgtgcgtcaactacatccactactat
ccggccaccaaactggaggtctgcaagagttccgtttccgaggagacgctcgagaattac
tttatttacatgaagcgcacggagcatcagcacggcgtgcatctgaatggagccaggtcg
tccaattaccggagcatcgagtggacccagccgcggatcgatcagctgtacaccatgtac
atgcaggagccgctgagcatgcagtgcaacaggtccgatggcactcgcttcgaggggcgc
gccagctgggagggcgtggcagcgacgcccgtccaaatccgcatacccattcaccgcaaa
ctgtgccccaactacaatccgctgtggctgaagccattggagaagggcgagtgcgatttg
ctgggggagtgcatctattag

DBGET integrated database retrieval system