KEGG   Drosophila sechellia: Dsec_GM11239Help
Entry
Dsec_GM11239      CDS       T01064                                 

Definition
GM11239 gene product from transcript GM11239-RA
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dse  Drosophila sechellia
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dsec_GM11239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1309 aa AA seqDB search
MRILKQWNRRRSGSSIVVLDGDDLKPCLPDDYISGQHHLNHQQQLQLQQQLQQQHPLQQQ
HYRTHSGDIREIDQEMLTMLSVNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQKHK
KSTNTTTTTTTTTTITTTTTTITAMTNNDHANKMLIVAYHSSHQHEQLQQQHPSKTSTTT
TIALDVATQNLYNQKQQNKLEQIENYENCLQSERNEQHEQQFEQQKQHQATSAVTATQVA
QQQTPSHKLQATLSSDPNGNSNSNNNSHTVGGGGGSSSSSNNSSITDDFLCVVDGLYQGR
KDSASPSSSAFDEVMSKHTLDSFGSIAYRHLHQQHQATSNGNSSNSNTSNTNSNTNGNTS
NNTAVSSKTATVTKTGVSSSNSNSNSLNSSNSSMHTSSSSSGHSSNIASATSSSSATSSS
TVPDDLSLAPPGYEVSQQQQQQHLVATPVTMLLPPMAKHRELPVDVPDSFIEMVKTTPRY
PPPAHLSSRGSLLSNGSASTAHTTLSSMGVSPSPVTATAAAAAAAAAAAAATASACATTA
VAAAAVSGVAADGDARRVADELNGNAKPVPPPRDHLRVEKDGRLVNCSPAPQLPDRRAPG
NASSGSSGATTHPLQQQQIAQIVEPTLEQLDSIKKYQEQLRRRREEEERIAQQNEFLRNS
LRGSRKLKALQDTATPGKAVAQQQQQATLATQVVGVENEAYLPDEDQPQAEQIDGYGELI
AALTRLQNQLSKSGLSTLAGRVSAAHSVLASASVAHVLAARTAVLQRRRSRVSGPLHHSA
LGLQKDIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTPTPTPAIG
AATGSTLSSPVAGPKRNLGMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLDTMPMSM
PVNLPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRLGGAHRDTAV
LHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIP
SQSFQHQRETMKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYA
TTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVP
HTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKI
CVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDME
ARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctaaagcaatggaatcgccggcgctccggatcgagcattgttgtgctggat
ggcgacgatttgaagccatgtctgccggatgactacataagcggccagcaccatctgaac
caccagcagcagctgcaactgcagcagcagctgcagcagcaacatccgctccagcagcaa
cactatcgcacgcactcgggcgacatcagggagattgaccaggaaatgctgaccatgctg
tccgtgaaccaagataacggtccacaccgtgagatggccgtcgattgtccggacacgttc
atcgcacgcaacaagacgccaccccgatatccgccaccccgtccgccacagaaacacaag
aaaagcaccaacaccaccaccaccaccaccaccaccaccaccatcaccaccaccaccacc
acaatcacagctatgactaacaatgatcatgctaacaaaatgttaattgttgcatatcat
tcttcacatcaacatgaacaactacaacaacaacacccatcaaaaacatcaacaacaaca
acaattgcactcgatgtggccacacaaaatttgtataatcaaaaacaacaaaacaaattg
gaacaaatcgaaaactatgaaaattgcctgcaatcggaacgaaatgaacaacacgaacaa
caatttgagcaacagaagcaacatcaagcgacaagcgcagtgacagcaacacaggtggca
caacagcagacgcccagccacaagttgcaggcaacattgagcagcgatccgaatggcaac
agcaacagcaacaacaacagccacacagttggaggcggcggcggcagcagcagcagcagc
aacaacagcagcatcaccgatgacttcctgtgcgttgtggatggcctgtaccagggacgc
aaggactcggcctcgccctcatcgagcgccttcgatgaggtgatgagcaaacataccctg
gactcgttcggcagcatcgcctatcgtcacctgcaccagcagcatcaggcgacgagcaac
ggcaacagcagcaacagcaacacgagcaacaccaacagcaacaccaacggcaacacgagc
aacaacacagctgtttcgagcaaaacggcaacggtgaccaaaacaggcgtgagcagcagc
aacagcaacagcaactcgctgaacagcagcaacagctcgatgcacacgagcagcagcagc
agcgggcacagcagcaacatagccagtgccacatcatcctcatccgccaccagcagctca
acggtgcccgatgatctgagcctggcgccacccggctacgaggtgagccagcagcagcag
cagcaacatttggttgcaacgcccgtgaccatgttgctgccaccgatggccaagcatcgc
gagctgcccgtggacgtaccggacagttttatcgagatggtcaagaccacgccaagatat
ccgccaccagctcatctctcctcacgcggatcgctgctgtcgaacggcagcgcctccacc
gcccacaccacgctctcctcgatgggcgtgtcgccctcgcctgtcactgcaacagcagca
gcagcagcagcagcagcagcagctgcagcagcaacagcatcagcatgtgcaaccactgcg
gttgctgctgctgcggtttctggtgttgctgctgacggcgatgcgaggcgggtggccgat
gagctcaatgggaatgcgaagcccgtaccgccgccacgtgatcatctgcgggtggagaag
gatggccggctggtcaactgctcacccgcaccgcagctgccggatcgccgggcgccggga
aatgcgagcagcggcagcagtggcgccacaacgcatccactgcagcagcagcagatcgcc
cagatcgtggagcccactttggagcagctggacagcatcaagaaataccaggagcaactg
cgccgacgacgcgaggaggaggagcgcatagcgcagcaaaatgaattcctgcggaacagt
cttcgtggctcccggaagctgaaggcgctccaggatacggccacgcccggaaaagccgtt
gcccagcagcagcagcaggcaacgctggccacccaagtggttggcgtggagaatgaggca
tatctgcccgacgaggaccagccgcaggcggaacagatcgatggctatggcgaactgata
gcagcactcacccgcctgcaaaaccagctgagcaagagcggactgagcacgctggcgggt
cgcgtttcggccgcccacagtgtcctggccagcgccagtgtcgcccatgtcctggccgct
cgcaccgcagtcctccagcgacgacgttcccgcgtctccggtccactgcatcatagtgcc
ctcggattgcagaaggatattgtggagctgctaacgcaatcgaatacggcggcggccatc
gagctgggcaatctgctgaccagccatgaaatggagggtctactgctggcccacgatcgc
attgccaatcacacggatggcacgccctcgcctacgcccacgcccactccggcaattgga
gcggcgacgggatccacactcagcagtccggtggctggacccaagaggaatctaggcatg
gtggtgccaccgcccgtggtaccaccgccactggcgcaacgcggagcaatgccactgcct
cgcggggagtcgccaccgccggttccgatgccaccattggacacaatgcccatgtccatg
cccgttaatctgccgatgagtgcgtgctttggcactctaaacgaccagaacgacaacatc
cgtatcatccagatcgagaagtcaacggagccgctgggcgccacggtgcgcaacgagggt
gaggcggtggtcatcggcaggattgtgcgattgggtggagcacatcgtgacaccgccgtg
ttgcacgtacgggcgcatttcgactacgatccggaggacgatctgtatataccctgccgg
gagctgggcatcagcttccagaagggcgatgtgctgcacgtgatcagccgcgaggatccc
aactggtggcaggcgtatcgcgagggcgaggaggaccagacgctggccggtcttattcct
agtcagtcgttccagcatcagcgcgagaccatgaagctggccattgcggaggaggcgggt
ctggcgcgatcccgcggtaaggacggatcgggcagcaaaggagccacgctcctgtgtgcg
cgcaagggtcgcaaaaagaagaagaaggccagctccgaggcgggatatcctttgtacgcc
accacggcgccggatgaaacggatccggaggagatactcacctacgaggaggtggccttg
tactatccccgcgcaacccacaagcggcccatcgtcctcatcggcccgcccaacattgga
agacatgagttgcgccaacgcctgatggccgactcggagcgtttctccgccgcagtgcca
cacacatcacgagcccgcagggagggcgaagtgcccggagtggactaccacttcatcacg
cgacaggccttcgaggcggatattttggcgcgccgctttgtggagcacggtgaatacgag
aaggcctactacggcacatcactggaggccatacgcacggtggtggccagcggcaagatc
tgtgtgctcaacctgcatccgcagagcctcaagctgctgcgcgcctctgacctcaagccg
tacgtggtgctggtggcgccgcccagcttggacaagctgcgccaaaagaagctgcgcaac
ggcgaacccttcaaggaggaagagctcaaagacatcattgccacggccagggatatggag
gcccgttggggtcacctattcgacatgatcatcatcaacaacgacacggagcgcgcctac
caccaactgctggccgagatcaactcgctggagcgcgagccccaatgggtgcccgcccag
tgggtgcacaacaatcgcgacgagtcataa

DBGET integrated database retrieval system