KEGG   Drosophila sechellia: Dsec_GM11349Help
Entry
Dsec_GM11349      CDS       T01064                                 

Definition
GM11349 gene product from transcript GM11349-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsec_GM11349
   04330 Notch signaling pathway
    Dsec_GM11349
   04350 TGF-beta signaling pathway
    Dsec_GM11349
   04630 Jak-STAT signaling pathway
    Dsec_GM11349
   04068 FoxO signaling pathway
    Dsec_GM11349
Enzymes [BR:dse01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dsec_GM11349
Transcription factors [BR:dse03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dsec_GM11349
Mitochondrial biogenesis [BR:dse03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dsec_GM11349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2950 aa AA seqDB search
MNGAGGGNGSGTGGDDGSGNGSGAGNRISQMQHQQLQHLLQQQQQGQKGAMVVPGMQQLG
SKSPNLQSPNQGGMQQVVATQMGMVNSMPMSISNNGNNGMNAIPAQLNSLPYGVGQYGGP
GGGNNPQQQQQQLLGQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSGPTGQLVSGNP
QQQQMLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQQPGTSQQQQQQQGVGIGGTGVVANA
GTVAGVPAVAGGGAGGAVQSSGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENMNPN
REVCNVNYCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCTNSGCVICYPFRQN
HSVFQNANVPPGGGPAGIGGAPPGAGGAGGGAAGAGGNLQQQQQQQQQQQQQQQQQNQQP
NLTGLVVDGKQGQQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQVH
QQQVQQQELRRFDGMGQVGLSPVPAGGMQQQQQQGLAPVIRIQGAQPAVRVLGPGGPGGP
SGPNVLPNDVNSLHQQQQQMLQQQQQQGQNRRRGGLATMVEQQQQHQQQPNPAQLGGNIP
APLSVNVGGFGNTNFGGAAAGGAVGANDKQQLKVAQVHPQSHGVGAGGASAGAGVSGGQV
AAGSSVLMPADTTGSGNAVNPSQNAGGGAGGAGGGNGGNSGPPGDNEKDWRESVTADLRN
HLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQ
KELEEKRLKRKEQHQQMLMQQQGVANPVVGGAAGGAGSAAGVAGGVVLPQQQQQQQQQQQ
QGQQPLQSCIHPSISPMGGVMPPQQLRPQGPPGILGQQTAAGLGVGVGVTNNMVTMRSHS
PGGNMLALQQQQRMQFPQQQQQQPPGSGAGKILVGPPGPSPGGMVVNPALSPYQTTNVLT
SPVPGQQQQQQFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQQQQQQQQGMLLP
QSPFSNATPLQQQQQQATSNSFSSPMQQQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALN
AGAGAPGAGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNSSSANNNPPSVSSLMQQPL
SNRPGTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSS
SSAGSGTPLSSVSTPTSATMATSSGGGGNAGGGSSTTPASNPLLLMSGGTAGGGTGATTT
TSTSSSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASKGKL
DSIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEEGLDGE
VKIKTEAMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDSGATGGAVDIKPKMDTK
PLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDY
FEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVF
EAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNRYT
YCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVDCQECGRKQHQICV
LWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGE
VHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQE
YGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPP
SEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAE
LPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQK
KAKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPI
QDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNH
CKTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQ
SVQRCIQSLVHACQCRDANCRLPSCQKMKRVVQHTKNCKRKPNGGCPICKQLIALCCYHA
KNCEEPKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTSTAPAALQGPAAVSG
PTVVSGGVPVVGMSGVTVSQPVIPGQAGILPPGAGGMSPSTVAVPSPVSGGAGVGGMGGM
TSPHPHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPPVMNRP
MGGAGPNQNVNQLGGMGVGVGGVGGVGVGGVGVNQLNSGGGNTPGAPISGPGMNVNHLMS
MDQWGGGGAGGGGANPGGGNPQARYANNTGGMRQPTQVMQTNLIPPQQQQQMMGGLGGPN
QLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPSPGAGGGGGSATGGGLNTQQLAQIMQ
KIKNNPTNESNQHILAILKQNPQIMAAIIKQRQQSQINAGGGAPGPGGALQQQQAGNGPQ
NPQQQQQQQQQQQQVMQQQQMQHMMNQQQGASGPQQMNPNQQQQQQQVNLMQQQQQGGPG
GPGSGLPTRMPNMPNALGMLQSLPPNMSPGVSTQGGMVPNQNWNKMRYMQMSQYPPPYPQ
RQRGPHMGGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGGVPGGAGTVPGGDQYS
MANAAAASNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGMQQQQQQQQPLQQQQM
MQVAMPNANAQNPSAVVGGPNAQVMGPPTPHSLQQQLMQSARSSPPIRSPQPTPSPRSAP
SRTCCSLRLA
NT seq 8853 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagccggcggcggcaacggatccggaacgggtggcgacgacggcagtggcaac
ggctcaggagcgggcaacagaatcagtcaaatgcagcaccagcaactgcagcacctactc
cagcaacagcagcagggccaaaagggcgccatggtggtgcccgggatgcagcagctgggc
agcaagtcgcccaacctgcagtcacccaaccagggtggcatgcagcaggtggtggccact
cagatgggtatggtcaactcaatgcccatgtcaatatcgaataatggcaacaatggcatg
aacgccataccagctcaactcaacagtctgccctacggagtgggtcagtatggtggccca
ggcggtggcaacaatcctcagcaacagcagcaacaacttctcggccagcagatggcccaa
agaggcggcgtcgtaccgggcatgccgcagggtaatcggcccgttggcacagtggtgccc
atgtccacactcggcggcgatggatcagggcccacggggcagctggtaagcgggaatcct
cagcagcaacagatgctggcgcagcagcaaaccggagccatgggcccgcgtcctccgcaa
ccaaaccagctgctcgggcatcccggccagcagcagcagcaacagcagcctggcacctcg
cagcagcagcaacagcagcagggagtcggaatcggagggacaggcgttgtggccaatgca
ggaaccgttgctggcgtgccggcagtggcaggcggcggagccggtggcgccgtgcaatct
agcggccctggtggcgccaatcgcgatgtgcccgacgaccgtaagcgacagatccagcag
caactgatgctgctcctccatgcacacaaatgcaatcgcagggagaacatgaatccgaac
agggaagtgtgcaacgtcaactactgcaaggcgatgaaatccgtgctggcccacatgggc
acttgcaaacagagcaaggactgcaccatgcagcattgtgcctcctcgcgccaaatcctg
ttgcattacaaaacgtgcacaaacagtggctgcgtcatttgctatcccttccggcagaat
cattcggtttttcaaaatgcgaatgtaccgccaggaggcggaccggcaggaattggaggg
gcgcctccaggtgccggcggagcgggtggtggagcggctggagcaggcggtaatcttcag
cagcaacagcagcagcagcagcaacaacagcagcagcagcagcagcagaaccagcagccc
aatctgacgggtctggtggtggatggcaagcagggacagcaggttgcaccgggaggtggc
caaaatactgccatagttcttccccagcagcagggagcgggcggtgcaccgggtgcgccg
aaaacgcctgcggatatggtgcaacaattgacccaacagcagcagcaacagcaggtgcac
cagcagcaggttcagcagcaagaactccgtcgattcgatggcatgggccaagttggacta
tcgccggtgccagcaggtggtatgcaacagcagcagcagcagggtttggctcctgtgatt
cgcattcaaggcgctcagccggccgtcagggtgctgggaccaggcggtcccggcggccca
agtggaccaaatgttctgccgaacgatgttaacagcctgcatcaacaacagcaacaaatg
ctgcaacagcagcagcaacaaggccagaatcgaagacgcggtggccttgccaccatggtg
gagcaacaacagcagcatcagcagcaacccaatcccgcccagctgggtggcaacattcca
gcaccactctctgtcaacgtcggtggctttggcaataccaatttcggtggtgcagcagcc
ggcggagccgtgggagccaacgataagcagcaactgaaggtggcccaagtgcatccgcag
agccatggcgtaggagcgggcggagcatcagcgggcgccggagtgagtggtggtcaagtg
gcagccggttccagtgtcctgatgccagccgataccacgggcagtggtaatgcggtcaac
cccagccagaatgccggcggtggagctggaggtgccggcggtggcaatggcggaaactct
ggacctccgggcgacaacgagaaagactggcgggaatcggtgaccgccgatctgcgcaac
cacctcgtccacaaactggtgcaggccatcttccccacctcggatcccacgaccatgcag
gacaaacggatgcataatctcgtttcatacgcggaaaaggtcgagaaggacatgtacgaa
atggccaagtccagatcggagtactatcacctgctggccgagaagatctacaagattcaa
aaggagctggaggagaagcgtctgaagcgtaaggaacagcaccagcagatgctgatgcag
cagcagggcgttgcgaatccagtggttggaggagcggctggtggagcaggcagtgcagct
ggtgtagcgggcggtgttgtcttgccccagcagcaacaacaacagcaacaacagcagcag
cagggtcagcagcctctgcagagctgtatccatcccagcatcagtccaatgggcggtgtg
atgccgccgcagcagctgcgtccacaaggaccacctgggatattgggccagcagacggca
gcaggcctgggcgtcggcgtgggagtgaccaacaacatggttaccatgcgcagtcattcg
cccggtggcaacatgctcgccctgcagcaacaacagcgcatgcagttcccgcaacaacag
cagcaacaaccacccgggtctggagccggcaaaatactggtcggtccaccaggacccagt
cccggtggcatggtggtcaatcccgcgctctcgccttaccagacgaccaatgtgctcacc
agtccggtgccaggacagcagcaacagcagcagttcnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnagcaacaacagcaacagcagcagcagcaaggaatgttgttgccg
cagtcgccatttagcaatgccacacctctacaacaacagcagcagcaggcgactagcaac
agctttagctcaccaatgcagcagcaacagcagcagcaaggtcagcaacagcaacaacag
aagcctggcagtgtgctgaataatatgccgcccacgcccacgagtctggaagccctgaat
gcgggggctggagcgccaggagctggaggatccgcctccaatgtgacggtttcagctccg
agcccatcacctggcttcctgtccaacggcccgtcgattggcacgccctccaacaataat
aatagtagtagtgctaacaacaacccgccctcggtgagcagcctaatgcaacagccgctg
agcaatcggccgggtacgcctccttacatacccgcctccccagtgccggcgacaagtgcg
tccggattagcggcgagcagtacgcccgcatcagcagcagccacctgtgcgagtagtggc
agtggcagcaatagcagcagtggagcaactgcagcgggtgcaagttccacgtcatcatct
tcctcggcgggctcgggtacaccactcagctcggtatcgactcctacatcggccacgatg
gccaccagcagcggtggtggtggcaatgcaggaggcggatcatccactacgcccgctagc
aatccactgctcctcatgtctggaggaacggcaggaggcggaacgggagcgacgaccacc
acatcgacatcctcgagcagtcgcatgatgagcagctccagcagtctctcctctcagatg
gctgccctggaggctgcggcgcgagacaacgatgatgagacgccctcgccatccggcgag
aatacaaacggcagtggtggcagtggaaatgccggcggtatggcctctaagggcaaactt
gactccattaagcaagatgacgatatcaagaaggagtttatggatgacagctgtggcgga
aataacgatagctcgcagatggattgctcgacgggtggtggcaagggcaagaatgtgaac
aacgacggaaccagcatgatcaaaatggagatcaagacggaggagggactcgatggcgag
gtgaagatcaaaacggaggccatggatgtggacgaggctggaggatcgacagccggagag
catcatggcgaaggtggcggcggcagtggtgttggcggcggcaaggacaacatcaatggt
gcgcacgatagcggagcgacaggcggtgctgtggacataaaacccaagatggatacgaaa
ccactcgtaccggagccactggcaccgaatgcgggtgacaagaaaaagaagtgccaattc
aatcccgaggaactgcgcaccgctctcctgcctacgctagagaagctctacaggcaggag
cccgaatccgtgccctttcgctacccagttgatccccaggcgctgggcattcccgattac
tttgagatcgttaagaagcccatggacctgggcaccatacgcaccaacatccagaatgga
aagtacagcgatccctgggagtatgtcgacgacgtttggctgatgttcgacaatgcctgg
ctgtataatcgcaaaacatcgcgggtctatcgctattgcacaaagctttccgaagtcttt
gaggcggagattgatcctgtgatgcaggcactgggatattgctgcggcaggaagtacaca
tttaatccacaggtgctctgctgctacggcaagcagctctgcacgattccgcgggatgcc
aagtactacagctaccagaacagtctaaaggaatacggtgtcgcctcaaatagatacacc
tactgccaaaagtgctttaacgacatccagggcgatacggtcacactgggcgacgatcca
ctgcaatcgcaaactcaaatcaaaaaggatcagttcaaggagatgaagaacgatcatctc
gaactggagccgtttgtcgattgccaggagtgcggacgcaaacagcaccagatctgcgtg
ctctggctggattcaatttggcccggtggcttcgtgtgcgataactgcctgaaaaagaag
aactcaaagcggaaggagaacaagttcaatgcgaaacgcctgcccaccaccaagctgggc
gtgtacatagagacacgggtgaataatttcctcaagaagaaggaggctggtgccggcgag
gtgcacattcgtgtggtcagctcatcggacaagtgtgtagaggtgaagcccggcatgcgt
cgacgattcgtcgagcagggcgagatgatgaacgagttcccatatcgcgccaaagccctc
tttgccttcgaggaggtggacggcatcgatgtgtgcttctttggcatgcacgttcaggag
tatggatccgagtgcccggcgccgaatacgcggcgtgtttacattgcctatttggattcc
gttcatttcttccggccaagacagtaccgtacagcggtatatcacgaaatcctgctcggc
tacatggactacgttaaacagctgggctacacaatggcccatatctgggcctgtccgcca
tccgagggggatgactacatcttccactgccatcccacggaccagaagatacccaagccc
aagcgcctgcaggagtggtacaaaaagatgcttgacaagggcatgatcgagcgcatcata
caggactacaaagatattctgaagcaggcgatggaggacaaactgggctctgccgcagag
ctgccctactttgagggcgacttctggcccaatgtgctggaggagagcatcaaggaactg
gaccaggaggaggaggagaagcgcaagcaggccgaggccgcggaagcagcagctgcggca
aatcttttctcaatcgaggaaaacgaagtcagcggcgatggcaaaaagaagggccagaag
aaggccaaaaagtcgaacaaatcgaaagcggcgcagcgtaagaatagcaaaaagtccaac
gaacatcagtcgggcaacgatctctccgccaagatatatgcgaccatggagaagcacaag
gaggtcttcttcgtcatccgtctgcattcggcgcagtcggcagctagtttagcgcccatc
caggatcccgatccgctgctcacatgcgatctgatggatggacgcgatgccttcctcacc
ctcgcccgcgacaagcactttgagttctcgtcgctgcggcgcgcacagttctccactctg
tccatgttgtatgagctgcataaccagggtcaggacaagttcgtttacacctgcaaccac
tgcaagacggccgtggaaacgcgctaccactgcactgtttgtgatgacttcgatctgtgt
atcgtgtgcaaggagaaggttggccatcagcacaagatggagaagctcggcttcgacatc
gacgacggctctgcgctggcggatcacaagcaggctaatccgcaggaggcacgcaagcaa
tccgtccagcgttgcatccaatcgctggtgcacgcctgccagtgtcgcgatgccaactgc
cgcctgccatcgtgccagaagatgaagcgcgtcgtccagcacacgaagaactgcaagcgc
aagcccaacggaggatgccccatctgcaagcagcttatcgcactctgttgctaccacgcc
aagaactgtgaggagccgaagtgccccgtgccgttctgtcccaacatcaagcacaagctc
aagcagcagcagtcccagcagaaattccagcagcagcagttgttgcgtcgccgtgtggcg
ctcatgtcgcgtacatctacagctccagcggctctgcaaggtccagctgcagtaagcggt
ccgaccgtcgtctctggaggagtgcccgtggtgggcatgtccggtgtgacagttagccaa
ccggttatccccggtcaggcgggtatactgcctccaggggcgggtggcatgtcgccatct
acagtggcagttccatcgcctgtttcaggaggagcgggagtcggtggaatgggtggaatg
acatcaccacatccgcatcaaccaggtataggtatgaaaccaggtggcggtcactcgccg
tcgccaaatgtcctacaagtggtgaagcaagtccaggaagaggcagctcgtcagcaggtt
tcgcatggcggtggcttcggcaagggcgtacccatggcgccgcccgtaatgaatcgtcca
atgggcggcgcaggacccaaccaaaatgttaatcaacttggtggcatgggcgttggagtt
ggaggtgtcggtggtgttggcgttggtggagtgggtgttaatcaactgaattcgggtggt
ggcaatacaccgggtgccccgatttccggtcccggaatgaatgtgaatcatctgatgtcc
atggatcagtggggcggtggcggagccggcggcggaggtgccaatcccggcggaggcaac
ccacaagcccgctatgccaacaataccggcggcatgcgccagcccacacaggtgatgcaa
acgaatctgataccgccgcagcaacagcaacagatgatgggcggactgggcggacccaac
caactgggaggtggtcaaatgccagtcggcggacagcacggaggaatgggaatgggcatg
ggagccccgccaatggccggaactgttggcggggtgcgtccatctcccggagcaggaggt
ggaggtggaagtgcgactgggggcggtctaaatacccaacaactcgcccagattatgcag
aagattaagaacaatcccaccaacgagagcaaccagcacatccttgccatactgaaacag
aatccgcagatcatggcggcgatcatcaagcagcgccagcagtcgcagatcaatgcgggc
ggaggagctcccggccccggtggagccttacagcagcagcaggctggtaacggaccgcaa
aatcctcaacagcagcagcaacaacagcagcagcagcaacaggtgatgcagcaacagcag
atgcagcacatgatgaaccagcagcagggcgccagcggtccacagcagatgaatcccaac
cagcagcagcaacagcagcaggttaatctcatgcagcaacagcaacaaggtggacccgga
gggccaggttctggacttcccacgcgtatgcccaacatgcccaatgccttgggcatgctg
cagagtcttccgcccaacatgtcgccaggcgtttccactcagggaggaatggtgcccaac
caaaactggaacaagatgcgttacatgcaaatgagccagtacccgccaccgtatccgcag
cgccagcgtggtccgcacatgggcggagcgggacctggccccggccagcaacagttcccc
ggtggcggaggtggagcgggcaacttcaatgcaggtggtgctggtggtgcaggcggcgtt
gtcggtgtgggcggagtgcccggaggagccggcacggtgcccggcggcgatcagtactcg
atggcgaatgcggccgctgcctccaatatgctgcaacaacagcagggccaggtgggcgtc
ggagtgggtgtgggcgtgaaaccaggacccggccaacagcaacagcagatgggcgttggc
atgccgccgggtatgcagcagcaacagcagcaacagcaaccgctgcagcagcagcagatg
atgcaggtggcgatgccaaatgcgaatgcccagaatccgtcggcggtggtgggcggaccc
aatgctcaggtgatgggtccgccgacgccgcactctctgcagcagcagctgatgcaatcg
gcccgctcatcgccgcccattcgctccccgcagccaacgccatcgccacgttcggcacca
tcgcgcacgtgctgctccctccgcctcgcctag

DBGET integrated database retrieval system