KEGG   Drosophila sechellia: Dsec_GM11375Help
Entry
Dsec_GM11375      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM11375-PA
  KO
K02979  
small subunit ribosomal protein S28e
Organism
dse  Drosophila sechellia
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Dsec_GM11375
Ribosome [BR:dse03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    Dsec_GM11375
  Archaea
    Dsec_GM11375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
AA seq 65 aa AA seqDB search
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILTLLESERE
ARRLR
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaccagttgtgtgggcacgcgtcatgaaggttctgggccgcaccggctcccag
ggtcagtgtacccaggtgaaggtcgagttcctgggcgagcagaaccgccagatcatccgc
aacgtgaagggaccagttcgcgagggcgacatcctgacccttttggaatccgaacgtgaa
gccaggaggctgcgctaa

DBGET integrated database retrieval system