KEGG   Drosophila sechellia: Dsec_GM11518Help
Entry
Dsec_GM11518      CDS       T01064                                 

Definition
GM11518 gene product from transcript GM11518-RA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dse  Drosophila sechellia
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dse04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1180 aa AA seqDB search
MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGARGPGVSGSVPSARVPPLATSAATSA
AHAPPLGAGSVSGSGISIAQRPAPPVPHATPFGSASASSSSSSASAFASAAPATGAFGGT
YTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDKKLKIIMEQTGK
LNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILM
DLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVA
TVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMA
PERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEG
YNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRTYEIAKVDVPNWFQSIKDNRLRANG
DPTLQRATATGSAVGSGAGSLAGSGSAGGAVKYGRATPYAGQSPTNPQKTIKPTQIPSYQ
QQQSQFFMQSATQLPQTTTTTPTATTNCFGGSGNGTGRGNGSGGSGNGSGSSSSASPLSP
PSAGIGDLNRLYRKSPFMQRKLSNGSHHPHYKYNDESPKKESMFSSIGQSILRNLTTSPF
SQKKHNSAAATATTIPLPHNNQTLITDAATAAAAATATTPPNIAATALTTTPTTTPTWRL
PADNSQAYDSCDSSSNATTTTLNLGLSSPSPSLPRKQFPTESPTLQLTSQQQQQQQQQPQ
RLQPGNQSPIVLQRFYHQQNQLREKEAAERYQQQRQQPPVGVTSTNPFHSNYVPPPPSTH
STSSQSSTQSTCSQIAINPDSISPSSGSGTGNVAGLGIGSAPSSGLGAAGHFGAGGSGEQ
LQYQPLPIAAEATGTSPTLQPRSPEQQSDYGGSGNMVASKLSKLYARRQLLGQSSSSGAS
NSSLDGCSREQHDAGWFNTLAGAMKRQFATYVKTQSNSTATSLVASSMDRDQEPVHPQPP
AYRSVVNNGSGGKSYYYRTLSAASSSSNTSQSTSPTTEPLPGGGTSSFLRRYASSGPGGS
ISTPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQQPGSPLLHRRYVSAS
PPLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccattgagttcgagacgatcggcagtcggctgcaatctttggaggcgaagctc
caggcgcagaatgagtcccacgaccagatcgtcctttccggtgcgcgcggccctggcgtt
tccggttccgttccgtctgcccgcgttccgcccctggcgacatccgcagccacatccgcc
gcccacgcaccgcccctgggcgcaggttccgtttccggatcgggtatcagcatagcccag
cggccagcacctccagttcctcatgcgacgcccttcggcagcgccagcgcctcgtcatca
tcctcatccgcatccgcatttgcatccgcagcaccggcgacgggcgcgttcggtggaaca
tacaccccgcccacaactagagtgtcgcgagccacgcccacactgcccatgctttctagt
ggccccggtggcggactgaatcggacgcggccggtgatacttccgctgcccacgccgcca
catcctccggtttcggaaacggacaagaagctgaagatcatcatggagcagaccggcaag
ctgaacatcaacgggcggcagtatccgacggacatcaatgacctcaagcacctgggcgac
ctgggcaatgggactagcggcaatgtggtgaagatgatgcacctgtccagcaacacgatc
atcgccgtgaagcagatgcgacgcactggcaacgcggaggagaacaagcgcatcctgatg
gatctggatgttgtgctcaagtcgcatgactgcaagtacattgtcaagtgcctcggctgc
tttgttcgcgatccggatgtgtggatctgcatggagctgatgtccatgtgcttcgacaag
ctgctcaagctgtccaagaagccggtgccggaacagatcctgggcaaggtcacagtggcg
acggtcaacgcattgtcctatctgaaggacaagcacggggtcatccatcgagatgtgaag
ccctcgaacattctgatcgacgagcgcgggaacatcaagctctgtgatttcggaatcagc
ggtcgcctggtggactccaaggccaacactcgatccgcgggctgtgcagcttatatggcg
ccggagcgcatcgaccccaagaaaccaaagtacgacattcgcgcagatgtatggtcactg
ggcataacgctggtggagctggccaccgcgcgatccccgtacgagggatgcaacacggac
ttcgaggtgctcaccaaggtgcttgactcggagccgccgtgtttgccatatggcgagggc
tacaactttagtcagcagttccgcgatttcgtcatcaagtgcctcacaaagaaccatcag
gatcgacccaagtatccggagcttctggcccagcccttcatccggacttatgaaatagcc
aaagtagatgtgcccaattggtttcagagcatcaaggataaccgactgcgcgccaatggc
gatccaacgctccagagggcaacggcgactggaagtgcggtcggttctggggccggatct
ctcgcaggatcaggatccgcaggtggagctgtaaaatatggtagggcgacgccgtatgcc
gggcagagtcccacaaatccgcagaagacaataaaacccactcagataccgagttaccag
cagcaacagtcgcagtttttcatgcaatcagccacacaactacctcaaacaacaaccaca
acaccgacggcaacgacgaactgtttcggcggcagcggaaacggaactggaagaggaaac
ggcagcggcggaagcggaaatggtagcggaagcagcagcagtgccagtcctctatcgcca
ccaagcgccggaatcggcgatcttaaccggctttatcgcaaatcgccgttcatgcagcga
aaactgagcaacggatcccatcatccgcactacaaatacaacgacgagagccccaagaag
gagtccatgttcagtagcatcggtcaatcgattctacgcaatctgacaacatcgcccttc
agccaaaagaaacacaattcagcagcagcgactgcaacaacaataccactgccgcacaac
aaccaaacattgattacggatgcagcaacagcagcagcagcggcaacagcaacaacaccg
ccaaatattgcagctacagcgctcacgacaacgccaacgaccacgcccacttggcgcctg
ccagcggacaattcccaagcctacgacagctgtgatagtagtagtaatgcgaccacgacg
accttgaatttgggcctctcctcaccctccccctcgttgccgcgcaagcaattccccaca
gaatcgccgaccctgcaactcacgagtcagcagcagcagcagcagcagcaacaaccacag
cgattgcagccgggcaatcaaagtcccatagtgctgcagcgcttctaccaccaacagaat
cagctgcgcgagaaggaggcggccgagcggtatcagcagcagcgccagcagccgcctgtg
ggagtgaccagcacgaatccgtttcacagcaactatgtgccgccgccgccatcaacgcac
tccacctctagtcagtcctccacgcagtcgacgtgttcacaaatcgccatcaatcccgac
agcatatctccatcgtctggttccggaacgggaaacgtggcgggattgggaatcggatcg
gctccgtcatcgggattgggggcagctggtcactttggagcgggcggctctggcgagcag
ctgcagtatcagccgctgcccatcgcggccgaggcaacgggaacgagtcccacgctccag
cccagatcaccggaacagcagtcggattatggaggaagcggcaacatggtggccagcaag
ctgagcaagctgtacgcacgccgacaacttttgggccagagctccagcagcggagcgagc
aatagcagcctggatggttgcagtcgggagcaacacgatgcaggctggttcaacactctt
gctggtgccatgaagcgacagtttgccacctatgttaaaacccaatcgaattccacagcc
acgtcgctggtggcgtccagcatggatcgggaccaggagccagtgcatccgcagccgccg
gcgtacaggagcgtcgtgaataacggcagcggcggtaagtcctactactatcgcaccttg
tcggcggccagcagcagcagtaataccagccagagcacctcgcccacgacggaaccactg
cccggcggtggcaccagtagcttcctgcgtcgctatgccagcagcggaccgggaggtagc
atcagcacgccgcccagtccgcatatcttggcgggattggatcgcaggcatcgaagtcca
gatcctccgccacgctacaatcgcggacagtcgccgctgttgctgcgcaagaatctgctg
gagctgagtggccagcagcccggctctccgttgctgcaccgcagatacgtttcggcctcg
ccgccgctgccgccaccgcgtcgaggttctgaaagcgtgccgggatcaccgcagcatttc
cgcactcgcatccactatacacccgagccccagagacgcatctaccgtacgatagatcaa
tga

DBGET integrated database retrieval system