KEGG   Drosophila sechellia: Dsec_GM11535Help
Entry
Dsec_GM11535      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM11535-PA
  KO
K01587  phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dse  Drosophila sechellia
Pathway
dse00230  Purine metabolism
dse01100  Metabolic pathways
Module
dse_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dsec_GM11535
Enzymes [BR:dse01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dsec_GM11535
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dsec_GM11535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAICAR_synt AIRC
Motif
Other DBs
NCBI-GeneID: 6618591
NCBI-ProteinID: XP_002042850
FlyBase: FBgn0166478
UniProt: B4IGJ0
AA seq 428 aa AA seqDB search
MSTTTTSIEGYKLGKVIIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEI
SNTTNGQVFRLLNEAGIRTAYVKQCSAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVP
EGYRFSPPKQETFFKDDANHDPQWSEEQIISAKFELNGLVIGQDEVDIMRRTTLLVFEIL
ERAWQTKNCALIDMKVEFGICADGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLAAV
TATDLDTVKRNFIWVAEQLVDIVPKKDHLVVVLMGSASDISHSEKIATSCRSLGLNVELR
VSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNM
QVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK
ELRGVRNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacaaccacatccattgagggctacaagctcggcaaggtcatcatcgagggc
aagaccaagcaggtgtacgatctgccggagcagccaggattgtgcctgctcctcagcaag
gatcgcatcaccgccggcgatggtgtcaaagctcacgatctggccggcaaggcggagatc
tccaataccaccaacggccaggtcttcaggctgctcaacgaggcaggcattcgcaccgcc
tatgtgaaacagtgcagcgccaaggccttcatcgcccgcaaatgccagatgatacccatt
gagtgggtgacccgccgcctggccaccggttcgtttctcaagcgcaatgtcggagtgccc
gagggctacaggttctcgccgcccaagcaggagacgttcttcaaggacgatgccaaccac
gatccccagtggagcgaggagcagattatctccgccaaattcgagctgaatggcctggtg
atcggccaagatgaggtggacattatgcgtagaaccacactgctggtcttcgagattctc
gaaagggcgtggcagaccaagaactgcgccctgatcgacatgaaagtggagttcggtatc
tgcgccgatggcaacattgtgctggccgacatcattgattccgattcgtggcgtttgtgg
ccagcgggtgacaagcgtttgatggtcgacaagcaggtgtatcgcaatctggcagcggtg
actgccaccgatttggatacggtgaagaggaacttcatttgggtggccgaacaactggtt
gatattgtgcccaagaaggatcatctggttgtcgttctgatgggcagtgcctccgatata
tcgcacagcgagaagatagccaccagctgtcgatcccttggcctcaatgtggaactccgc
gtgagttccgcccacaagggaccggaggaaacgctgcgcattgtccgcgaatacgaatcg
gtgatgagcaacctgatctttgtggccgtcgccgggcgatccaatggactgggtccagtc
gtttccggcagcaccaactatccggtaattaattgtccgcccgtcaaatcggacaacatg
caggtggacgtgtggtccagcttgaatctgccatcgggcctgggctgtgccacagtccta
tatccagaggcagctgctctgcatgcggccaccattctggggctgggcaacttcatggtc
tggtcgaaattgcgtgtcaaggcgctcaacaactttatcactctcaagaaggccgacaag
gagttgcgcggcgtgcgaaatgcttag

DBGET integrated database retrieval system