KEGG   Drosophila sechellia: Dsec_GM11599Help
Entry
Dsec_GM11599      CDS       T01064                                 

Definition
GM11599 gene product from transcript GM11599-RA
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dsec_GM11599
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dsec_GM11599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 334 aa AA seqDB search
MSKRHRLTPFTIAKEPEAAIVPPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIV
DKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWI
CMEVMSTSLDKFYPKVFLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILI
NRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGM
IEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEGTFSPEFEDFIAVCLQKEYMARPNYEQ
LLKHSFIVEHLQRNTDISEFVARILDLPDAQPAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacgccaccgcctcacgccctttaccattgccaaggagccagaggccgccata
gtcccgccacgcaacctggactcgcgggccaccatccaaattggcgaccgtacctttgac
atcgatgcagatagtctcgagaagatctgcgatctgggccgtggcgcctatggaatcgtg
gataagatgcgccataagcaaaccgatacggtcctggccgtcaaacgcatacccatgacc
gtaaatattcgagaacagcaccgccttgtgatggatttggacatatcgatgagatccagt
gactgcccctataccgtccacttctatggagcgatgtaccgcgagggcgatgtctggatc
tgcatggaggtgatgagcaccagcctggacaagttctatccgaaggtcttcctccacgat
ctgcgaatggaggagagtgtgctgggcaagattgccatgagcgtggtcagtgcgctgcac
tatctgcacgctcaactgaaagtcatccatcgggacgtcaagccctcgaacatactgatc
aatcgggccggtcaggtcaagatctgtgactttggcatctcaggctacctcgtggactcc
attgccaaaaccatcgatgctggttgcaagccgtacatggcgccggaacggatcgatccc
cagggaaatccggcgcaatacgacatcaggtcggatgtttggtcgctgggcatcggcatg
atcgaaatggccactggccgctacccgtacgacaattggcgaacgccatttgagcaactg
cgtcaggtggttgaggacagtccgccgcgcctgccggagggaaccttttcgccggagttc
gaggacttcatcgccgtctgcctgcagaaggagtacatggcgcggcccaactatgagcag
ctgctcaagcacagcttcatcgtggagcacctgcagcgcaacacggacatctcggagttc
gtggccaggatactggatctgcccgacgcccagccggcgcagtag

DBGET integrated database retrieval system