KEGG   Drosophila sechellia: Dsec_GM11612Help
Entry
Dsec_GM11612      CDS       T01064                                 

Definition
GM11612 gene product from transcript GM11612-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
dse  Drosophila sechellia
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dsec_GM11612
  Energy metabolism
   00920 Sulfur metabolism
    Dsec_GM11612
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dsec_GM11612
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dsec_GM11612
    3.1.3.25  inositol-phosphate phosphatase
     Dsec_GM11612
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 355 aa AA seqDB search
MSEAKMNGRSIRINRLPATIVAILLTIVLVYFLNFHQEERPAIYGMLRSDNPSRVNLRKM
LIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFP
RVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELY
EYVTTMVCVAVAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVS
RSHTAGAMDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAIL
HALGGTMTSLNDQLINYGPEESPVNTEGLLATLEQHDEYMDKLSKYREAHNGKLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggccaagatgaacggacgctccattcgcatcaaccggctgccggccaccatt
gtggccatcctgctgaccattgtcctggtctacttcctcaatttccaccaggaggagcgg
ccggcgatctacggcatgctgcgcagtgacaatcccagccgcgtcaatctacgcaagatg
cttatagccgccatacaggccgcccagcgtggcggactcgaggtactggacgtggcccga
agtcgccagctgaaggagcgcagcaagggcaagacggacgagggcgtcaatgatccgttc
acggatgccgacggccggtcacattgtgtgatgaagcagggcctacagcgaatctttccc
cgcgtacaaatcttctccgaggaggacaaggagcactgcaagcaggcgcacggctatgat
ctggatccaacggtcctccacgagaccgcacagataccggatgtgaccgtaaatgcccag
gatgtcactgtttgggtagatccgctggatgccaccaaggagttcaccgaggagctatac
gagtacgtgaccaccatggtgtgcgtggcggtggccggaagacccatcatcggcgtgatc
cacagcccgttcaatggacaaaccgcgtgggcgtgggtgggcaactcgatgtccgagtac
ctgtccaatctacatccacagcattcgccaaacaatcaggcgcccatcatcacagtctcg
cgatcccacacggcgggtgccatggatctggcgagaggcatctttggcgagaatgtcagc
ctgctgacggcggcgggagctggctataaggtgctccaggtggtggccaacaatgccacc
gcctatctgcacacgtcgaagatcaagaagtgggacatatgcgccggcgatgccattctg
cacgcactgggcggcacaatgacctcgctgaatgatcagttgattaactacggaccagag
gaatcgccagtcaatacggagggtctgctggccaccttggagcagcacgacgagtacatg
gacaagctgtctaaatatcgcgaagcacacaatggcaagctggcgtag

DBGET integrated database retrieval system