KEGG   Drosophila sechellia: Dsec_GM11729Help
Entry
Dsec_GM11729      CDS       T01064                                 

Definition
(RefSeq) GM11729 gene product from transcript GM11729-RA
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM11729
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM11729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1022 aa AA seqDB search
MRVIAPRRSSTSAAGSGSLYGTSAVGTSSGSTTSSNSTSGSHHISSTGSGAVDRTTGGAA
TNGYSRISSSYDRGSSLSKWLPTSSGGSNSSGYGTSYYPSSYSTYSANSGSSSASYAPRS
SVQRSSVGTTSSTSYMSAGSVSSSSAYRTSSYLSGFSYDSPTYSRYGNYTNEDSLSGSAK
REDYGLRRGHDTAKKPPISGASVGHNCSNSASRDTKAVDGNKRLSSSSSSPSLARLVATS
GLEIYEKYSPANYKPNCELSRSRSGHSETDLENGSNKEATPTCTVTLERPRSSTSRYSRL
YRNSSDAGGDSSASTGKLSSGKYSISSSSSSGNVPTATFTLRSNRTRRSQEEEAPTSTEV
EQAGPAAPSPTPIPPPPPPPTNGHKPAESNGGLEAKLNGLSLLSTSPKRNAIYERNQDTT
DDAGVGQDSADNADVSTSATFKLNDSSKNRQTPGSGSGIGPGSVTAAGLGGGRLSGASRT
NHGSQAGGSSSNLQQRYSSDLDNIRVAAGYSSSLTRAAYRTTATMKRVSTPEAATSELGG
PISGGGGEVATAMVQPTSKVTVRGAHSIRQPIECDSLVLTNKDATTAATPTVATATASAT
HTPATSSVSTVTVTAAAPNSASDSTLARSGTGSSSTARSVLPPMTPTSSRYWDRDSGTSR
SSIGTSSALNSSSLKHNLDDGYKSASSSRDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQE
LTRFLRSHHGSRSLSTKDQQILHEFAKLIQEMWTSNVHTVTPMELKRAFSTKHRMYSDYN
QQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSLVRDLFV
GQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLDACLDLFIREEVLDGDEMPTCAK
CKTRRKCTKSFTIQRFPKYLVIHLKRFSETRWSKLSNIVEFPTSDSELNMGSYGANSNSN
VHYSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSDALSENHLVSSSAYILFYE
RT
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaattgcgccgcgtagatcgtcaacgtcagcggcgggcagcggcagtctctac
ggtacatcggcggtcggcacctccagcggcagcaccaccagcagcaactccaccagcggc
agtcaccacatcagcagcaccggcagcggtgcggtggatcggaccaccggaggcgccgcc
acgaacggttactcccgcatatcgagcagctacgaccgcggcagtagcctgtccaagtgg
ctgcccacctcgtccggcggctcaaactcgtcgggctacggcaccagctactatcccagc
tcgtactcaacgtactccgccaacagcggctcctcaagcgcctcttatgcgccgcgctcc
agtgtgcagaggagcagcgttggtaccacgtcgtcaacgtcgtatatgagcgccggatcc
gtcagcagctcgtccgcctaccgcacctcctcgtacctgagcgggttcagctatgattca
cctacgtacagccgatacggaaattacaccaacgaggacagcttgagcggatcggccaag
agggaagactacggtctacggcgtggccatgataccgccaagaaaccaccgatcagcgga
gcaagtgttggccacaactgcagcaacagtgcgagtagagacaccaaagccgtcgatggc
aacaaacggctgtccagttcatcctcatctccatcgctggcccgtttggtggccacctcc
ggactggaaatttacgaaaagtacagtccggccaactataaacccaactgtgaactgtca
cgttccaggtcggggcattctgagacggatctagaaaacggaagcaacaaagaggcgacg
cccacctgcacggtgaccctggagagaccaaggagcagcaccagtcgatacagccgcctg
tacaggaacagcagcgatgcaggaggggactcctcggcttccacgggaaaattgagctcc
ggcaagtactcgattagcagcagcagtagcagtggcaatgtgcccacggccacctttaca
ctccgaagcaaccgcacgcggcgcagtcaggaggaggaggcacccacgagcacggaagta
gagcaggcaggcccagcagctccatcaccaacgccaataccaccgccaccacctccaccc
acaaatgggcacaagccggctgagtcgaatggcggactggaagccaaattaaacggtcta
tcgctgctctcaacttcgcccaaaagaaatgccatttacgaacgaaatcaggacaccaca
gatgatgcaggtgttgggcaggatagtgccgacaatgccgatgtgagcacctcggccaca
tttaagctaaacgacagcagcaagaacagacaaactccgggctctggatcaggaatagga
cctggcagtgttacagcggccggtttaggaggaggacggctgtctggggctagccgtacc
aatcacggatcgcaggcaggcggtagcagcagcaatctgcagcagcgctacagcagcgac
ctggacaacatacgcgtggcggctgggtatagtagttccctgaccagagcagcctatcgg
actacagccacaatgaagagggttagcacgccggaagcggcaacctctgaactaggcggt
cctattagtggcggaggaggagaagtcgccacggcaatggttcagcccacaagcaaggta
acggtaaggggtgctcacagcatccggcagccaatcgaatgcgatagcctggtcttgacc
aacaaggatgcaacgacagcggcaacacctactgttgccactgccactgcctcagcaaca
catacaccagccacgtcttccgtctccacagtcacagtcaccgccgcagctccaaactcc
gccagcgatagtacgttggcgagaagtggcactgggagtagcagcactgcccggagcgtc
ctgcctcccatgacgcctacgtcaagtcggtactgggatcgggacagcggcaccagccgc
agcagcataggcacctcctccgcactgaactcatcatccctgaaacataacttggatgac
ggctacaagagcgcctcctcttcgcgggatgagaagtccgaaggtctgtgcggtctgcga
aacattggcaacacatgctttatgaactcggtcatccagtgcctgagtcacactcaagag
ctgacccgcttcttgcggtcgcaccacggctctcgctcgttatccaccaaggatcagcag
atactccacgaatttgccaaactcattcaggagatgtggacctctaacgtgcacacggtg
acgcccatggagctaaagagggcgttctcgaccaaacatcgcatgtacagcgactacaac
caacaggatgcgcaggagttcctgcgttttttccttgactcgctgcattcggccctcaat
tcgggcgtcaagggtgagacgctcaacattgacgataatctcagtgacaataagaaggcg
gacttgacctgggagtggtatacgcggcacgagaactctttggtgcgcgacctatttgtg
ggtcagctcaaaagcacactgaagtgcaccacctgcggtaacaccagcgtcaccttcgat
ccgttctgggatctgagcgtaccgttgccgtcttcttcccgctgcaagctagatgcttgc
ctcgacctctttatccgcgaagaggtccttgacggcgacgaaatgcccacgtgcgccaag
tgcaagacgcggcgaaaatgcaccaagagcttcaccattcagcgtttccccaaatatctg
gttatacacctaaaacgcttttcggagacacgttggagcaagctgtccaacatcgttgaa
tttcccacatcagacagcgagctgaacatgggctcctatggcgccaactccaactcgaat
gtgcattactcgctttatgcgatatctaatcatatggggtcaacggctggtggtcattat
gttgccctttgcaagcatccagtttcccgcaagtggcacgaatttaatgataatatagtc
agcgatgccttgtccgaaaaccatcttgtttcatccagtgcctatattcttttctacgag
cgtacgtaa

DBGET integrated database retrieval system