KEGG   Drosophila sechellia: Dsec_GM11758Help
Entry
Dsec_GM11758      CDS       T01064                                 

Definition
GM11758 gene product from transcript GM11758-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsec_GM11758
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM11758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFVQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEEPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatatcgttgta
aacaccgacgaggagccgattttgtttaaggcccagttgtttgccctgactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctgaaggatgaccagtggaatctg
cagatcaaggacggcgctgtggtcctgttgctgggcagcaaggaaagtgttccagaagtg
cctgccactccggtcaaattcattgaggacatgaacgaagctgaggcagccacagcgatg
cgtctaccggctgggctgacaaatctgggcaatacgtgctacatgaacgccactgtccag
tgcctgaacgcagtgcccgagctccgcactgccctgagcactttcagtaacgatggaacc
gacaccatgtcgaccgcattttccatatcatctgccatgaagtctatatttgttcaaatg
gagaagggcacaactgtgacgccaattgtgctgctgcaggctttgcaccgggcatccccg
caatttgcccagactggcgaaaatggcacatacaggcagcaggacgccaatgagtgctgg
gcagagatcctgaaaatgttgcagcaaaaactgcggccaacaaaccaggaaccatcgaat
actgtccagaagaggcacagctcgtttatcgatcagttttttggtggcacttttgaagtt
aagatgagctctgaagaggaacccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttccatggatgttaagtacatgcagagcggtctgaaatctaaa
atgaaagagcagctggtgaaaaaatctgaaaccctgggacgcgatgcaaagtacattcga
acttacttggtgagccgacttccagcctatctcaccgtacaatttgtgcgctttcaatac
aaaggaaaggagggcataaatgccaaggtgttgaaggatataaaatttcccattgacttc
gatgcctttgagttgtgtacccccgaattgcaaaacaagctctgcccaatgcgctcaaaa
ttcaaggatctggaagacaagaaaatggaagttgacgttgtcaaacgcaatgaacccaac
gaagagaagaaggacgttaagtacgagcagttctggttcgacgacgacttgggcagcaac
aattcgggatactatacgctgcaggcggtgctcacgcacaagggacgctccagttcgtcg
ggtcattatgtggcctgggttcgctccagcggcgatgtgtggttcaagttcgatgatgat
gaggtctccgccgtggccactgacgagatcttgcggctttccggcggcggagactggcat
tgcgcctatgtcctgttatatgcgcccagacgtttggagaaactataa

DBGET integrated database retrieval system