KEGG   Drosophila sechellia: Dsec_GM11758Help
Entry
Dsec_GM11758      CDS       T01064                                 

Definition
GM11758 gene product from transcript GM11758-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIVVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSNDGTDTMSTAFSISSAMKSIFVQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEEPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPIDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatatcgttgta
aacaccgacgaggagccgattttgtttaaggcccagttgtttgccctgactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctgaaggatgaccagtggaatctg
cagatcaaggacggcgctgtggtcctgttgctgggcagcaaggaaagtgttccagaagtg
cctgccactccggtcaaattcattgaggacatgaacgaagctgaggcagccacagcgatg
cgtctaccggctgggctgacaaatctgggcaatacgtgctacatgaacgccactgtccag
tgcctgaacgcagtgcccgagctccgcactgccctgagcactttcagtaacgatggaacc
gacaccatgtcgaccgcattttccatatcatctgccatgaagtctatatttgttcaaatg
gagaagggcacaactgtgacgccaattgtgctgctgcaggctttgcaccgggcatccccg
caatttgcccagactggcgaaaatggcacatacaggcagcaggacgccaatgagtgctgg
gcagagatcctgaaaatgttgcagcaaaaactgcggccaacaaaccaggaaccatcgaat
actgtccagaagaggcacagctcgtttatcgatcagttttttggtggcacttttgaagtt
aagatgagctctgaagaggaacccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttccatggatgttaagtacatgcagagcggtctgaaatctaaa
atgaaagagcagctggtgaaaaaatctgaaaccctgggacgcgatgcaaagtacattcga
acttacttggtgagccgacttccagcctatctcaccgtacaatttgtgcgctttcaatac
aaaggaaaggagggcataaatgccaaggtgttgaaggatataaaatttcccattgacttc
gatgcctttgagttgtgtacccccgaattgcaaaacaagctctgcccaatgcgctcaaaa
ttcaaggatctggaagacaagaaaatggaagttgacgttgtcaaacgcaatgaacccaac
gaagagaagaaggacgttaagtacgagcagttctggttcgacgacgacttgggcagcaac
aattcgggatactatacgctgcaggcggtgctcacgcacaagggacgctccagttcgtcg
ggtcattatgtggcctgggttcgctccagcggcgatgtgtggttcaagttcgatgatgat
gaggtctccgccgtggccactgacgagatcttgcggctttccggcggcggagactggcat
tgcgcctatgtcctgttatatgcgcccagacgtttggagaaactataa

DBGET integrated database retrieval system