KEGG   Drosophila sechellia: Dsec_GM11799Help
Entry
Dsec_GM11799      CDS       T01064                                 

Gene name
Dsec_ST6Gal
Definition
Sialyltransferase
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dse  Drosophila sechellia
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:dse00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dse00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 451 aa AA seqDB search
MRQVTRASSGQSQALLSCLIIAVCAALIIQAGQIQGAKAQPGREPGEVNSRQPGNGNGTT
GHRVPRSVFHVRWNPNEKFIVESRENPAINSSKLAPHPRLKVSKNTKLTLSPKLYLCHDK
HSELCHNKTQQFRQRIVRAFEKAMVESVNESQANHYNVDYKPVFGDSFEEQYYPSTCLVM
EAGVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKTCAIVSSAGSLAGSKLGRFIDTHD
IVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFTRAPIFRNVTIAAWDPGKYNGT
LEDWLTSADYDLFTNYELYRRRYPKSRAFLIDPHSVWRLWQSLQMFAGNRPISRNPPSSG
FIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMNSACTFGSWHPLAAEKLMALDMNM
AEDDDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaagtgacacgcgcatcgtcgggtcaaagtcaggccctcctttcatgcctcatt
atcgccgtgtgcgccgcattaataattcaagctgggcaaattcagggtgcgaaagctcag
ccgggacgcgaacccggcgaggtgaattcgcggcagcccggcaacggaaatgggaccact
ggccaccgcgtgccgcgcagtgtgttccacgtgcgctggaatcccaacgagaagttcatc
gtggagagtcgcgagaacccggccatcaactcctccaagctggctccgcatccccgactc
aaggtctccaagaacaccaagctcacactgagccccaagctgtatctctgccacgacaag
cactcggagctgtgccacaacaagacccagcagttccgccagcgcattgtccgggccttc
gagaaggccatggtggagtcggtaaacgagtcgcaggcgaaccactacaacgtggactac
aagcccgtcttcggggacagcttcgaggagcagtactacccctcgacctgcctggtcatg
gaggcgggcgtgcgggtcctgcgccgcaaggacgcgcccttcaacaagctgcccttcggc
cggcttttcccgcgccagaagctcttccgcaacgtcaaggacatcaagacctgtgccatc
gtctccagtgcgggatccttggctggctccaagttaggccgcttcatcgacacgcacgac
attgtgatgagattcaatcatgcgcccacgcaaggacacgaggtggatgttggcagcaaa
accacgatccgtgtggtgaattcgcaagtggtcaccaagccggaattcgacttcacccgg
gcccccatcttccggaacgtcacgatcgccgcctgggatccgggcaagtacaatggtacg
ctggaggattggctcaccagtgctgactacgacctcttcaccaactacgagctgtacagg
cggcgctatcccaagtcgcgcgccttcctcatcgatccccactccgtgtggcgcctgtgg
cagagtctgcagatgtttgccggaaaccggccgataagcaggaatccccccagttccggt
ttcataggactggccctgctcctgccgcactgtccccaggtggacttcgtggagtacgtg
ccgtccacacgactcaatggacgctgtcactactacagcaaagagatgaattccgcctgc
acattcggctcctggcatccgctggccgccgagaagctgatggccctggacatgaacatg
gcggaggacgacgatatgtcggtcttccagttcggcatcctgcggatacgcaggccggac
aagctgctctgcggcttcaacttctttggctactga

DBGET integrated database retrieval system