KEGG   Drosophila sechellia: Dsec_GM11923Help
Entry
Dsec_GM11923      CDS       T01064                                 

Definition
GM11923 gene product from transcript GM11923-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsec_GM11923
   04150 mTOR signaling pathway
    Dsec_GM11923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 964 aa AA seqDB search
MASISDDGMALSGNLKKLKTMKKKFFVLYEETSTSSARLEYYDTEKKFLQRAEPKRVIYL
KNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHS
PYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTT
IRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAVATNMHNMILSAMSAKTESNTNLI
NVYQNRPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLELRSCSSPHNYGFSRERCDS
LPTRNGTLSESSNQTYFGSNHGLRFNTISGIRPHSTNKHSNSPTFTMPLRCSESEDSSIS
VDESDDNGSFSHYRLNTRTSETAIPEENIDDFASAEFSKVTEPNESDENYIPMNPVNPTD
AIHEKEKADLQRLEDASLHFNFPEHASEKLAKDFDLDSDNQCCRPIRAYSIGNKVEHLKF
NKRLGHLNDTGQNPNRVRAYSVGSKSKIPRCDLQRVVLVEDNKHEFASNRSQSSIGKEGS
SYGSSANRQKKSTSAPLLSLKNQINSDRMSDLMEIDFSQATNLEKQKFIKNNEIPKYIEN
VFPKAPRTDSSSLTLHATSQKDIFNGSKLNNTAITSEDGYLEMKPVGNGYTPSSNCLPIK
VEKLKLSDYQTTAPPLLTATAAPVQDLNKISTYNISAEKWREQPSRSEEKKSNSPLNDNP
FSLKPTNVESKSKSHDVHSANQIDCEKVCVQSDKLNNLTDKIVENNNLDIGGHEEKKLVH
SISSEDYTQIKDKANDFTKFNEAGYKILQIKSDSSLISSKLYQKGMHKDNLERTHRLTES
VNTIPDNATATVGSSSLTKFNINSVKPAADSRSTGTDPSTAQNILQIKDLNFPSRSSSRI
SQPELHYASLDLPHCSGQNPAKYLKRGSRESPPVSACPEDGNTYARIDFDQSDSSSSSSN
IFNT
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatcggatgacggcatggcgctgagtggcaacctcaagaagctgaagacc
atgaagaagaagttctttgtgctgtacgaggagacgagcacttcatcagcccggctggag
tactacgataccgaaaagaagttcctgcaaagagccgagccaaaaagggttatctatctg
aagaattgcttcaacatcaatcgccgcttggacaccaagcatagatttgtcattgtgctc
tcctccagagacggtggattcggcatcgttctcgagaacgaaaatgatctacgcaaatgg
ctggacaaactactagttctgcaaaggaacatagccaattcgaatggaacagcgcactca
ccttatgaccaagtttggcaagttgtcattcaaaagaagggtatttcggagaaagttgga
atcaccggaacctaccactgttgccttacttcaaaatccctgacattcgtgtgcattgga
ccggagaagacgcccaatggcgaggatcgcgttgcgagcattgaaatacttttgaccacg
atcaggcgatgcggtcatgcatccccacaatgtatattctacgtggaactcggccgccaa
agtgtcttgggatctggtgatctgtggatggagacggataatgcagctgttgctactaat
atgcacaacatgatactgagcgctatgtcagccaaaacagagtcgaacacgaatttaata
aacgtttatcagaacagacctgacttaagtcacgagcccatgagaaagcgatcgtcgtct
gcaaacgaagcttcgaagccgataaacgtaaacgtcatacaaaatagtcaaaactctctc
gaattgcgcagctgcagttcgccccataactatggttttagcagagaaagatgcgatagc
ttaccaaccagaaatggaaccctaagcgagtccagcaatcaaacgtactttggttccaac
catggactgcgattcaatactatatctggcatccgtccgcactcaaccaacaagcatagt
aatagtccaacgttcaccatgccattgagatgctcagaatccgaagattcatcaattagt
gtcgatgaatccgacgacaacggcagttttagccactacagattaaacacgcggacatcg
gagacggctattcctgaggaaaacattgatgactttgccagtgcggaatttagcaaagtc
accgaaccaaatgaaagtgacgaaaactacataccgatgaatccagtcaatcctaccgat
gctatccatgaaaaggagaaggctgacctgcagagattggaagatgcatctctgcatttc
aactttccggagcacgcgtcggaaaaacttgctaaggattttgatctggactctgataac
caatgctgtcgtcccattcgcgcctattcgataggcaacaaggtagagcatttaaagttt
aataagcgcctcggccacttgaatgatacgggacaaaatccgaatcgcgtgagagcctac
tcggtgggttccaagtcgaagataccgcgctgcgacctgcagcgagtggtcctcgtggag
gacaataaacatgagttcgcgtcgaataggagtcagagtagcattggcaaggagggatcc
agctatggcagcagtgccaatcggcaaaagaagtccacaagtgctccactactcagtctg
aagaaccagataaactccgaccgaatgagtgacttaatggaaattgatttttcacaagca
accaatttggaaaagcagaagttcatcaagaacaatgaaattccgaaatacattgaaaac
gtgttcccaaaagccccccgaacggatagctccagcctaactctgcacgccacaagtcag
aaggacattttcaatggcagcaaactgaataacacagcgatcacatccgaggatggttac
ctcgagatgaagccagtcggtaatggatacactcccagttcgaattgccttccaatcaaa
gtggagaagctcaagctatcagactatcagactaccgcaccgccactcctcaccgcaaca
gccgcaccagtgcaggatttaaacaaaattagcacatacaatatatccgctgagaaatgg
agagagcagcccagcagaagcgaggagaagaagtcgaactcgccactgaatgacaacccc
tttagcttgaaacccacaaatgtcgagagtaaaagcaaaagccatgatgtgcattcagca
aatcaaattgattgcgagaaggtgtgcgtgcagagcgataagctaaataatctgacggac
aagattgtcgagaacaacaatttggatataggcgggcatgaggaaaagaagttggttcat
tcgataagcagcgaagactacacacaaatcaaggacaaagcgaatgatttcacaaaattt
aacgaggccggctacaaaattctgcaaattaaaagcgacagctcactcatctcatcgaaa
ttataccaaaagggtatgcacaaggataacctggagcgtacacatagacttacggagagt
gtgaatacgattccggataatgccaccgccaccgtcggcagcagctcgctcaccaaattc
aatataaattcagtaaagccagccgccgattcgcgcagcactggcacagatccaagtaca
gcacagaacattctacagattaaagatttgaatttcccctcacggtcgtcgtcccgcata
tcccagccggagctgcactacgccagcctagatcttccccattgcagcggccaaaatcca
gctaaatacctaaagagaggatcacgcgaatcgccgccggtgtccgcgtgcccggaggat
gggaatacctatgcgagaatcgactttgaccaatccgactcctcttcctcctcatcgaac
atatttaatacgtaa

DBGET integrated database retrieval system