KEGG   Drosophila sechellia: Dsec_GM12137Help
Entry
Dsec_GM12137      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12137-PA
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dse  Drosophila sechellia
Pathway
Autophagy - animal
Longevity regulating pathway - multiple species
Wnt signaling pathway
Hedgehog signaling pathway - fly
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsec_GM12137
   04341 Hedgehog signaling pathway - fly
    Dsec_GM12137
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dsec_GM12137
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsec_GM12137
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsec_GM12137
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Dsec_GM12137
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsec_GM12137
Chromosome [BR:dse03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dsec_GM12137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MSQHNSQYVFNSKEDYNVILDNMSHEFEERWNHQTQSPYTNLENYITRAVLGNGSFGTVM
LVREKSGKNYYAAKMMSKEDLVRLKQVAHVHNEKHVLNAARFPFLIYLVDSTKCFDYLYL
ILPLVNGGELFSYHRRVRKFNEKHARFYAAQVALALEYMHKMHLMYRDLKPENILLDQRG
YIKITDFGFTKRVDGRTSTLCGTPEYLAPEIVQLRPYNKSVDWWAFGILVYEFVAGRSPF
AIHNRDVILMYSKICICDYKMPSYFTAQLRSLVESLMQVDTSKRLGNSNDGSSDVKGHPW
FQGVDWFGILNQEVTAPYQPTISGAEDLSNFENFEFKDRYKSRINRHPELFANF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacaattcgcagtacgttttcaactccaaggaagactacaacgttatccta
gacaacatgagtcacgagttcgaagagcggtggaaccaccagacccagtcgccctacacc
aacctggaaaactatataacccgggccgtcctcggcaacggaagtttcggcactgtgatg
ctggtcagggaaaagagtggcaagaactactatgccgccaagatgatgagcaaggaggat
ctggtgcggctgaagcaggtggcccacgttcacaacgagaagcacgtcctgaacgccgcc
cgattcccgttcctcatctacctggtggactcgacaaagtgcttcgactatctctaccta
atcctcccgctggtcaatggaggtgagctgtttagttaccatcgtagagttcgcaagttc
aacgagaagcacgccagattctatgccgcccaggtggcacttgctcttgagtatatgcac
aagatgcacctcatgtaccgtgatctgaagccggagaacattctgctcgatcagcgcggc
tacatcaaaataacggacttcggtttcactaagcgtgtggatggccgcacatcaacgctg
tgtggaaccccggaatacttggccccggagatcgttcaactccgaccctacaacaaatcg
gtggactggtgggcctttggtatcctagtttacgagtttgtggctgggcggtctcccttt
gccattcacaatcgagatgtaatcctgatgtactccaagatctgcatatgcgactacaag
atgccctcttactttacggcccagctgaggagcctcgtcgagagcctcatgcaggtggac
acctcaaagcgtttaggaaactcgaacgacggctctagcgacgtgaagggtcatccgtgg
ttccagggcgtagattggttcggcattctcaaccaggaagtcaccgccccctaccagccc
accatttccggcgccgaagatctgtcgaacttcgagaacttcgagttcaaggatcggtac
aagtcccgaataaaccgccatcccgaattgtttgcgaatttttaa

DBGET integrated database retrieval system