KEGG   Drosophila sechellia: Dsec_GM12138Help
Entry
Dsec_GM12138      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12138-PA
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dse  Drosophila sechellia
Pathway
dse04140  Autophagy - animal
dse04213  Longevity regulating pathway - multiple species
dse04310  Wnt signaling pathway
dse04341  Hedgehog signaling pathway - fly
Module
dse_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dsec_GM12138
   04341 Hedgehog signaling pathway - fly
    Dsec_GM12138
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dsec_GM12138
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dsec_GM12138
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dsec_GM12138
Protein kinases [BR:dse01001]
 Serine/threonine kinases: AGC group
  PKA family
   Dsec_GM12138
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsec_GM12138
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dsec_GM12138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 6612900
NCBI-ProteinID: XP_002037392
FlyBase: FBgn0167079
UniProt: B4HZU4
AA seq 356 aa AA seqDB search
MGPQPEQTQMHFSPKVDYILILDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGK
VQLVRERESGIYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtccccaaccggagcaaactcagatgcacttcagtcccaaggtggactacatcctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacacgccgtcgccc
agtacgggactggatgactacgagattaaggcgaccctcggatccggatccttcggcaag
gtgcagttggtgagggagcgcgagtccggcatctattacgcctccaagcagctcagcaag
gatcagatcgtgaagaccaaacaggtgagccacgtgatgagcgagaagaacgtgctgcga
tcgatgacattcccgaacacggtcaacctgatagcctcctacaaggactttgacagcctc
tacctcgtcctgcctctaattggtggcggagagctcttcacctaccaccgaaaagtgcga
aagtttacggaaaaacaggcccgcttctatgctgcccaggtgtttttggctctggagtat
ctgcatcattgcagcttgctctatagagacctcaaaccggagaacataatgatggataag
aacggatacttgaaagtgacagatttcggatttgccaagaaagtggaaacccgtacaatg
actttgtgcggaacgccggagtacctgccgccggagattatccaatcgaagccctacgga
accagcgtggactggtgggcttttggggtactggtctttgaattcgtcgctggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgtgaggcggac
tataagatgcccagttacttcagtggagccctgcgtcatttggtggaccatttgctgcag
gtggatctctccaagcgttttggcaacctgatcaacggcaatcgggacataaaggagcac
gagtggttcaaggatgtggagtggatccccctcctcaatcagacagttaacgcgccctat
gtgcccaacatcagcaatcccgaggatatatccaacttcgataaggtctctgataaaccg
cggcccaaggcgaaaaccatgcgacacgaggaagccttcgcggacttttaa

DBGET integrated database retrieval system