KEGG   Drosophila sechellia: Dsec_GM12138Help
Entry
Dsec_GM12138      CDS       T01064                                 

Definition
(RefSeq) GM12138 gene product from transcript GM12138-RA
Organism
dse  Drosophila sechellia
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 356 aa AA seqDB search
MGPQPEQTQMHFSPKVDYILILDKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGK
VQLVRERESGIYYASKQLSKDQIVKTKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSL
YLVLPLIGGGELFTYHRKVRKFTEKQARFYAAQVFLALEYLHHCSLLYRDLKPENIMMDK
NGYLKVTDFGFAKKVETRTMTLCGTPEYLPPEIIQSKPYGTSVDWWAFGVLVFEFVAGHS
PFSAHNRDVMSMYNKICEADYKMPSYFSGALRHLVDHLLQVDLSKRFGNLINGNRDIKEH
EWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDKVSDKPRPKAKTMRHEEAFADF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgggtccccaaccggagcaaactcagatgcacttcagtcccaaggtggactacatcctc
atcctggacaagttgcgcgaggacttcaacaagaagttcgccaccaacacgccgtcgccc
agtacgggactggatgactacgagattaaggcgaccctcggatccggatccttcggcaag
gtgcagttggtgagggagcgcgagtccggcatctattacgcctccaagcagctcagcaag
gatcagatcgtgaagaccaaacaggtgagccacgtgatgagcgagaagaacgtgctgcga
tcgatgacattcccgaacacggtcaacctgatagcctcctacaaggactttgacagcctc
tacctcgtcctgcctctaattggtggcggagagctcttcacctaccaccgaaaagtgcga
aagtttacggaaaaacaggcccgcttctatgctgcccaggtgtttttggctctggagtat
ctgcatcattgcagcttgctctatagagacctcaaaccggagaacataatgatggataag
aacggatacttgaaagtgacagatttcggatttgccaagaaagtggaaacccgtacaatg
actttgtgcggaacgccggagtacctgccgccggagattatccaatcgaagccctacgga
accagcgtggactggtgggcttttggggtactggtctttgaattcgtcgctggacactcg
cccttctcagcccacaatcgcgatgtgatgagcatgtacaacaagatctgtgaggcggac
tataagatgcccagttacttcagtggagccctgcgtcatttggtggaccatttgctgcag
gtggatctctccaagcgttttggcaacctgatcaacggcaatcgggacataaaggagcac
gagtggttcaaggatgtggagtggatccccctcctcaatcagacagttaacgcgccctat
gtgcccaacatcagcaatcccgaggatatatccaacttcgataaggtctctgataaaccg
cggcccaaggcgaaaaccatgcgacacgaggaagccttcgcggacttttaa

DBGET integrated database retrieval system