KEGG   Drosophila sechellia: Dsec_GM12153Help
Entry
Dsec_GM12153      CDS       T01064                                 

Definition
GM12153 gene product from transcript GM12153-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dse  Drosophila sechellia
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dse04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 420 aa AA seqDB search
MSKAVNDMSMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQRE
YEQFLASKEAERVKELERERERERERQRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSA
PDLGLLDQVVYPNDFPTGANRSLPGSGLLLPVASEAATDKTTNSKPSFDRNQKPSYNRTD
SLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGT
PDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVC
APKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLRR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaatgacatgagcatgggcgacgtggagccgcaggagaggatgaag
cacctgtcgcactgcggcaacctgatcgaggtggacaagaacatgccagtcacgcggtac
taccgctctggcaccgagatgctgcgcatggccaatgtttacctgcgggagggcaaccac
gaaaacgcattcatcctgtacttgcgctatatgaccctgttcattgagaagatccgccag
cacccggattacggcagcgtcaaggccgaggtgcgggatattaacaggaagattaaggac
gagattatgcccacgacggagaagctgagagccaagctactaacgcactaccaaagagag
tacgagcagtttctggccagcaaggaggcggaacgggtcaaagaactggagcgcgaacgg
gagcgggaaagggaacgtcagaggcagaaggaaagggagaaggcaggttcaagtgctatt
ccatccctcatcccggccaatttgcacgtgctcatcgacgaaggcaaccagccatcggct
ccggacctgggcctgcttgaccaggtggtctaccccaatgactttcccacgggcgccaat
cgcagcctgccgggatcgggactcctgctgcccgttgccagcgaagcagccaccgataag
acaaccaactccaagccaagcttcgatcgcaatcagaagccatcttacaaccgcacagat
tctctgctggctggctctttgcgcctcgtttacgtgcccggggacaccatggaggtgttt
ctgaagctggccctggccaacacctcgaaaaacattgagacatgcggcgtactggctggt
catctgtcccagaaccagctgtacatcactcacatcattacgccgcaacagcaaggaact
ccggacagctgcaacacgatgcacgaggagcagatattcgatgtgcaggaccagatgcag
ctcattacgctgggatggattcatactcatccaacccagactgcgtttttgtcctccgtt
gacctgcatacgcattgctcctatcagattatgatgcccgaagccttggccattgtgtgc
gcgcctaagtacaacactactggtttctttatactcacgccacattacggcctggactac
atagcccaatgtcgccagtcgggttttcatccgcatcctaatgacccgccgctcttcatg
gaggcgcagcacatccgaatggataaccaggccaagatcaaggtcattgatctgcggaga
tag

DBGET integrated database retrieval system