KEGG   Drosophila sechellia: Dsec_GM12153Help
Entry
Dsec_GM12153      CDS       T01064                                 

Definition
GM12153 gene product from transcript GM12153-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dse  Drosophila sechellia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dse00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dsec_GM12153
Enzymes [BR:dse01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dsec_GM12153
Peptidases [BR:dse01002]
 Metallo Peptidases
  Family M67
   Dsec_GM12153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 420 aa AA seqDB search
MSKAVNDMSMGDVEPQERMKHLSHCGNLIEVDKNMPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGSVKAEVRDINRKIKDEIMPTTEKLRAKLLTHYQRE
YEQFLASKEAERVKELERERERERERQRQKEREKAGSSAIPSLIPANLHVLIDEGNQPSA
PDLGLLDQVVYPNDFPTGANRSLPGSGLLLPVASEAATDKTTNSKPSFDRNQKPSYNRTD
SLLAGSLRLVYVPGDTMEVFLKLALANTSKNIETCGVLAGHLSQNQLYITHIITPQQQGT
PDSCNTMHEEQIFDVQDQMQLITLGWIHTHPTQTAFLSSVDLHTHCSYQIMMPEALAIVC
APKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIRMDNQAKIKVIDLRR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaatgacatgagcatgggcgacgtggagccgcaggagaggatgaag
cacctgtcgcactgcggcaacctgatcgaggtggacaagaacatgccagtcacgcggtac
taccgctctggcaccgagatgctgcgcatggccaatgtttacctgcgggagggcaaccac
gaaaacgcattcatcctgtacttgcgctatatgaccctgttcattgagaagatccgccag
cacccggattacggcagcgtcaaggccgaggtgcgggatattaacaggaagattaaggac
gagattatgcccacgacggagaagctgagagccaagctactaacgcactaccaaagagag
tacgagcagtttctggccagcaaggaggcggaacgggtcaaagaactggagcgcgaacgg
gagcgggaaagggaacgtcagaggcagaaggaaagggagaaggcaggttcaagtgctatt
ccatccctcatcccggccaatttgcacgtgctcatcgacgaaggcaaccagccatcggct
ccggacctgggcctgcttgaccaggtggtctaccccaatgactttcccacgggcgccaat
cgcagcctgccgggatcgggactcctgctgcccgttgccagcgaagcagccaccgataag
acaaccaactccaagccaagcttcgatcgcaatcagaagccatcttacaaccgcacagat
tctctgctggctggctctttgcgcctcgtttacgtgcccggggacaccatggaggtgttt
ctgaagctggccctggccaacacctcgaaaaacattgagacatgcggcgtactggctggt
catctgtcccagaaccagctgtacatcactcacatcattacgccgcaacagcaaggaact
ccggacagctgcaacacgatgcacgaggagcagatattcgatgtgcaggaccagatgcag
ctcattacgctgggatggattcatactcatccaacccagactgcgtttttgtcctccgtt
gacctgcatacgcattgctcctatcagattatgatgcccgaagccttggccattgtgtgc
gcgcctaagtacaacactactggtttctttatactcacgccacattacggcctggactac
atagcccaatgtcgccagtcgggttttcatccgcatcctaatgacccgccgctcttcatg
gaggcgcagcacatccgaatggataaccaggccaagatcaaggtcattgatctgcggaga
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system