KEGG   Drosophila sechellia: Dsec_GM12168Help
Entry
Dsec_GM12168      CDS       T01064                                 

Definition
GM12168 gene product from transcript GM12168-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dse  Drosophila sechellia
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dse01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dse01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 420 aa AA seqDB search
MCLSSPIPGQKQTPSVGHCNGSCSLDRNGNRNEASVPNGGELKHRGHATDATSHSLVKDE
DNLGYKEENAVYKEQQLLQQQDQKLKEAEQVEKEEEYHPQIRWPDLGAQAFLHIGALYGL
YQLFYANFYTFLWVVVTVWVSGIGITAGAHRLWSHKSYTASLPLRILLAFAFSIAGQRDA
YTWALDHRIHHKFSETDADPHNAKRGFFFAHVGWLFLTPHPKVVAKRKVIDMSDLEADAV
CMFQRKYYIPLFALCSIILPVAVPWYFWNEDLWMSFWINFNMRFTWTLNVAFFVNSVAHM
YGNKPYDKNLMSTEAPIVSLLAMGEGWHNYHHVFPWDYKTGEFGNYSLNITTGFIDFCAW
LGLATGRKSVSPDMVLRRAKKCGDGTRFLDDDHAHKDPVWGFGDKDIPREDIVELAKMQN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctttcatccccgattcccggccagaaacagacgccgtctgttggccactgcaac
gggtcgtgtagcctggacaggaatggcaaccgcaatgaagccagtgtcccgaatggagga
gagctgaagcacagaggccatgccacagacgctacatcacacagcctggtcaaagatgag
gacaatctgggctacaaggaggagaacgcggtctacaaggagcagcagctgctgcagcaa
caggaccagaagctgaaggaggcggagcaggtggagaaggaggaggagtaccacccgcag
atcagatggcccgatctgggggcacaggccttcctgcacatcggtgccctctacggactg
taccagctcttctacgcgaacttctacacatttctctgggtggtggtcaccgtttgggtc
tccggcatcggcatcacggctggagcccatcgcctctggtcccacaagtcctacactgcc
tcgctgcccctgaggattctgttggcctttgccttttcgatcgccggacagagagatgcc
tacacgtgggcccttgaccacaggatacatcacaagttctcggagacagacgccgatccg
cacaatgcgaagcgtggtttcttcttcgcccacgtgggctggctgttcctcacgccccat
cccaaggtggtggctaagaggaaggtcatcgacatgtccgacctggaggcggatgccgtc
tgcatgttccagcggaagtactacataccgctcttcgcgctttgctccatcatccttccg
gtggccgtgccctggtacttctggaacgaggacctctggatgtccttctggatcaacttc
aacatgcgcttcacctggaccctcaacgtggccttcttcgtgaacagcgtggcgcacatg
tacggcaacaagccgtacgacaagaaccttatgtccactgaggctcccatcgtctccctg
ctggccatgggagagggatggcacaactaccaccacgtcttcccctgggactacaagacg
ggcgagtttggcaactacagcctcaacatcaccaccggcttcatcgacttttgcgcctgg
ctgggtctggctacaggacgtaaatcggtatcccctgacatggtcttgaggagagccaag
aaatgcggcgatggaactcgcttcctggacgacgaccatgcccacaaggatccggtgtgg
ggcttcggggacaaggacattccccgagaggatatagtggagctggccaagatgcagaac
taa

DBGET integrated database retrieval system