KEGG   Drosophila sechellia: Dsec_GM12172Help
Entry
Dsec_GM12172      CDS       T01064                                 

Definition
GM12172 gene product from transcript GM12172-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dse  Drosophila sechellia
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dsec_GM12172
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dsec_GM12172
Enzymes [BR:dse01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dsec_GM12172
Lipid biosynthesis proteins [BR:dse01004]
 Desaturase
  First
   Dsec_GM12172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 478 aa AA seqDB search
MGHLSTSERVCSKTPANAADSSPSLVARRSKFPNGDAQQQVRRGEDSSPELPPRGKLLLP
PKREELPRSVVPKEIASHVPKDAIDLEEYTRTFVGDRVLGWQFQAPLKWDKVIQISLLHI
VAGICLLTYPLRELNPYTTIWSFFVGGVAGFGVTAGAHRFWTHKSYKANTVLRSILMVCY
CVAGQNTLYDWVRDHRVHHKYSETDADPHNANRGFFFSHVGWLMMLKHPEVLRRGRQIDM
SDILADPVVRFHQKFFIPLKTFFCFILPTVIPVYCWGETWTLAFIQQCLFRYVSSLNFTW
SVNSAAHLWGSRPYDNPTLQTYLTDLVLSSSPGRIMPSENIYVSLLAMGEGWHNYHHVFP
WDYKAAELGNYTVNFTTMVLDAFHQLGWAWNMKQPSKELVRRTLEKYGDGTHASQLGGPE
EFKDGVVAGSTMVGHVHYAEVPDPELEYDAESSSTESAKLDENENEGERMKKSKKAAN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacctgtccacctcggagcgagtgtgcagcaagacgccggccaatgcggcggac
tccagtccttcgcttgtggccaggaggtcgaagttccccaatggagatgcccagcagcag
gtgcgcaggggagaggactcctcgcccgaactgccgccccgtggcaagctcctgctgcct
cccaagcgggaggagctgcccaggtcggtggtgcccaaggagatcgccagtcacgtgccc
aaggatgcaattgacctcgaggagtacacccgcaccttcgtcggagatcgcgtgctgggt
tggcagtttcaggctccgctcaagtgggacaaagtcatccagatctcgctcctgcacatc
gtggccggaatatgcctgctgacgtatccgctgcgggagctcaatccgtacaccaccatc
tggtccttcttcgttggcggcgtggccggattcggagttacggccggagcccacaggttc
tggacccacaagagctataaggccaacaccgtgctgcgatccatcctgatggtctgctac
tgcgtggctggacagaacaccctttacgactgggttcgcgaccaccgagtccatcacaaa
tactcggagacggatgcggatccccacaacgccaacaggggattcttcttctcccacgtg
ggctggctgatgatgctgaagcatccggaggtacttcgtcgtggtcgccagatcgacatg
agcgacattctggctgatcccgtggtgcgcttccaccagaagttcttcatccccctgaag
accttcttctgcttcatcttgcccaccgtgatcccagtctactgctggggcgagacctgg
accctggccttcatccagcagtgcctcttccgctacgtgagcagcctgaacttcacgtgg
tctgtgaacagtgccgcccatctgtggggatcccgcccatacgataacccaactctacag
acatatctaactgatctggtcctatcttcctctccaggccggatcatgcccagcgagaac
atctatgtgtccctgctggccatgggcgagggatggcacaactaccaccacgtgttcccc
tgggactacaaagcagctgagctgggcaactacaccgtgaacttcaccaccatggtgctg
gatgcgttccaccagctgggatgggcctggaacatgaagcagccctccaaggagctggtg
cgtcgcaccctcgagaagtacggcgatggcacccacgcctcccagctgggcggtcccgag
gagttcaaggacggagtggtagccggatccaccatggtgggtcacgtgcactacgccgaa
gtaccggatcccgagctggagtacgatgccgagtccagcagcacggagagcgccaaatta
gatgagaacgagaacgagggcgagcggatgaagaagtccaagaaggcggccaactag

DBGET integrated database retrieval system