KEGG   Drosophila sechellia: Dsec_GM12179Help
Entry
Dsec_GM12179      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12179-PA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00051  Fructose and mannose metabolism
dse00562  Inositol phosphate metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
dse01230  Biosynthesis of amino acids
Module
dse_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dse_M00002  Glycolysis, core module involving three-carbon compounds
dse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM12179
   00051 Fructose and mannose metabolism
    Dsec_GM12179
   00562 Inositol phosphate metabolism
    Dsec_GM12179
Enzymes [BR:dse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dsec_GM12179
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dsec_GM12179
  Exosomal proteins of bladder cancer cells
   Dsec_GM12179
  Exosomal proteins of melanoma cells
   Dsec_GM12179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6612821
NCBI-ProteinID: XP_002037322
FlyBase: FBgn0167119
UniProt: B4HZM4
AA seq 348 aa AA seqDB search
MPPGVLTKLNRNGIQCIASVTLLQRFPYHRNHHTIPTMDQNRPTVGGVTAEVLKAVVSQA
LLGKFTAVFPKLFKCQWKTYEGQKKFYANFSTDCTDSNSNNMSRKFCVGGNWKMNGDQKS
IAEIAKTLSSAALDPNTEVVIGCPAIYLMYARNLLPCELGLAGQNAYKVAKGAFTGEISP
AMLKDIGADWVILGHSERRAIFGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTN
EVVARQMCAYAQKIKDWKNVVVAYEPVWAIGTGKTATPDQAQEVHAFLRQWLSDNISKEV
SASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctggagtactcactaagctgaacaggaacggtatccagtgcattgcatcagta
acacttctccagcgattcccatatcatcggaaccaccacaccattcccaccatggaccag
aaccgacccactgtgggtggtgttacggcggaggtactaaaagccgtcgtttcgcaagct
ctgctgggcaaattcacagctgttttcccaaagctttttaagtgccagtggaagacttac
gaaggtcaaaagaagttctacgccaatttcagcaccgattgcaccgacagcaacagcaac
aacatgagccgaaagttctgcgtgggaggcaactggaagatgaacggcgaccagaagtcc
atcgccgagatcgccaagaccctgagctcggccgccctcgaccccaacacggaggtggtc
atcggctgcccggccatctacctgatgtacgcccgcaacctgcttccctgcgagctgggt
ttggccggccagaacgcctacaaggtggccaagggcgccttcaccggcgagatctcgcct
gcgatgctgaaggatatcggcgccgactgggtgatcctgggacactcggagcgccgcgcc
attttcggcgagtcggacgccctgatcgccgagaaggccgagcacgctctggccgagggc
ctcaaggtcatcgcctgcattggtgagaccctggaggagcgcgaggccggcaagaccaac
gaggtggtggcccgccagatgtgcgcctacgcccagaagatcaaggattggaagaacgtg
gtggtggcctacgagcccgtctgggccattggcaccggcaagaccgccacacccgatcag
gctcaagaggtccacgccttcctgcgccagtggctgagcgacaacatctccaaggaggtg
tccgccagcctgcgcatccagtacggtggatccgtgaccgccgccaacgccaaggagcta
gccaagaagcccgacatcgatggcttcctggtcggaggcgcctccctgaagcccgagttc
gtggacatcatcaacgcccggcagtaa

DBGET integrated database retrieval system