KEGG   Drosophila sechellia: Dsec_GM12271Help
Entry
Dsec_GM12271      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12271-PA
  KO
K03259  translation initiation factor 4E
Organism
dse  Drosophila sechellia
Pathway
dse03013  RNA transport
dse04150  mTOR signaling pathway
Module
dse_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM12271
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsec_GM12271
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dsec_GM12271
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsec_GM12271
Translation factors [BR:dse03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsec_GM12271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 6612635
NCBI-ProteinID: XP_002037139
FlyBase: FBgn0167208
UniProt: B4HZ41
AA seq 199 aa AA seqDB search
MENSRQSKESSELKRGTSVDDYKLASLGATNKHQLQNTWTLWGVNYDPEIPWEDMLKEID
SFDTVEDFWNLYFSIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTNSVDKRFSAE
LDKIWLDVLLCIIGEACDHCDQICGALVRIRKNINKISVWTKADAGDEAVREIGHKLSCE
VLNLKGEKNWIFFPHGSQD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactcaaggcaaagcaaagaatcgtcggaattaaaaagggggacttctgtggat
gattacaaacttgcatcgttaggtgccacaaacaagcaccagctgcagaacacatggacc
ctgtggggcgtaaactacgatcccgaaataccgtgggaggacatgctgaaggagattgac
agcttcgataccgtcgaagacttctggaacctgtatttcagcatcgatacgccatccaag
ctcaaccgcggctgtgattacatgctcttcaagaagggcattcgccccatgtgggaggat
ccgccgaacaagggcggaggtcgttggacaaacagtgtggataaaaggttctcagccgaa
ctggacaaaatttggctggacgtgcttctttgcattattggcgaggcctgcgatcactgc
gatcagatctgtggggctttggtcaggattcgcaaaaatatcaacaaaatctccgtatgg
acaaaggcagacgctggcgatgaggccgtccgggagattggtcacaagctgagctgtgag
gtcttgaacctcaaaggggaaaaaaattggatattctttccgcatgggtcccaagattga

DBGET integrated database retrieval system