KEGG   Drosophila sechellia: Dsec_GM12352Help
Entry
Dsec_GM12352      CDS       T01064                                 

Definition
GM12352 gene product from transcript GM12352-RA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dse  Drosophila sechellia
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dse04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:dse04340]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 488 aa AA seqDB search
MREEEEAALRNTKSILQFLKKKKSHHSSTSGEGKLQAQSSCEEEGGAAAGGAGAAAGPPA
DQASSSSSGPSSAAAAHKSTPPAATTTPGSGADSGGASGGTGGGGGGPNTSGDDQAQVSA
SATFRLSSLTGTISKMGNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDD
FERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPF
LVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDL
IYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWW
ALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYG
NLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEK
CAKEFAEF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggaagaggaagcagcactgcgtaacactaagtccattttgcagttccttaaa
aagaaaaagtcccatcatagttccacatccggcgagggcaagctacaggcgcagtccagt
tgcgaggaggagggcggagcggcagcgggaggagcgggagcggcagcgggacctccagcg
gaccaggctagcagcagcagcagcggcccctcgtcagcagccgccgcccacaagagcacg
ccccctgccgccacgaccacgcccggttcaggggcggattcaggaggagccagcggagga
acgggaggagggggaggaggacctaacacgtccggcgacgatcaggcccaagtgtcggcc
agcgcaacgttccgtttgtcatcgctaacgggcaccatctccaagatgggcaataacgcc
accacgtcaaacaagaaggtcgatgccgccgagacggtgaaggagttcctcgagcaggcc
aaggaggagttcgaggacaagtggcgacgcaatccgaccaacaccgccgccctcgatgac
ttcgaacggatcaagaccctgggcaccggctcctttggccgtgtcatgatcgtccagcac
aagcccacgaaagactattatgccatgaagatcctcgacaagcagaaggtggtcaagctg
aagcaggtggagcacacgctgaacgagaagcgaatcctgcaggccattcagttccccttc
ctcgtctcgctgcgctaccatttcaaggacaactccaacctctacatggtgctggagtat
gttcccggtggcgagatgttctcccacctgcgcaaggtgggccgcttctcggagccgcac
tcgcgcttctacgcggcgcaaatcgtgctggccttcgagtacctgcactacttggacctc
atctaccgcgatctgaagccggagaatctgctgattgactcgcagggctacctcaaggtg
acggacttcggttttgccaagcgggtcaagggccgcacctggacgctgtgcggcacgccc
gaatacctggccccggagatcattctgtccaagggctataacaaggccgtcgactggtgg
gcgttgggcgtactcgtctacgaaatggccgctggctatccgccgttctttgcggatcag
ccgatccagatctacgagaagatcgtctccggcaaggtgcgtttcccatcgcactttggc
tccgatctgaaggacctactgcgcaacctgctgcaggtggatctgaccaagcgctacggc
aatctaaaggcgggcgtcaatgatattaagaaccagaagtggttcgcctccaccgactgg
attgcgatcttccaaaagaaaatcgaggcgccgttcattccgcggtgtaagggtcccggc
gacacgagcaatttcgatgactacgaggaggaggcgctgcggatctccagcaccgagaag
tgtgccaaggagtttgctgaattctag

DBGET integrated database retrieval system