KEGG   Drosophila sechellia: Dsec_GM12472Help
Entry
Dsec_GM12472      CDS       T01064                                 

Definition
GM12472 gene product from transcript GM12472-RA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 223 aa AA seqDB search
MESPSARTLGNSPGDDSGNGNGNGNGNGSGNGNTTMMPHGIYHERQTRHLCGLHALNNLF
QGLDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRNCEAMWFDRRRD
PRCLNLSAIFGFILNVPAQMSLGYYIPLPFQMRHWLALRRLNGSYYNLDSKLREPKCLGN
EEQFLEFLATQLQMDHELFLVLEVETDCKDKCRQRWLLPQFRD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcccagcgctcgaacactcggcaattccccgggcgatgacagcggcaacggg
aatggaaacgggaatggaaatggaagtgggaacggaaacaccacgatgatgccgcatgga
atctaccatgagcgacagactcgccacctgtgcggcctccacgccctgaacaatctgttc
caggggctcgacatgttctccaaatcggaactggacgactactgcaccacactgaccccg
cgcaactggctgaatccgcatcgatcgtggatcggttggggcaactacgacgtcaatgtg
atcatgtacgcactgcagcagcggaattgcgaggcgatgtggttcgaccgccggcgggat
ccacgctgtctcaatctgagcgccattttcggcttcattcttaatgtgccggcccagatg
agcctgggctactacattccgctgcccttccagatgcgccactggctggcactgcgtcgc
ttgaacggcagctactacaatctggactccaagctgcgcgagcccaagtgcctgggcaac
gaggagcagttcctcgagtttctggccacccaactgcagatggatcacgagctattcctt
gtgctggaagtggagacggactgcaaggataagtgccggcaacgttggctgctgccgcag
ttcagggactaa

DBGET integrated database retrieval system