KEGG   Drosophila sechellia: Dsec_GM12650Help
Entry
Dsec_GM12650      CDS       T01064                                 

Definition
GM12650 gene product from transcript GM12650-RA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dse  Drosophila sechellia
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    Dsec_GM12650
Enzymes [BR:dse01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     Dsec_GM12650
Glycosyltransferases [BR:dse01003]
 Glycan extension
  Type 3 chain
   Dsec_GM12650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 379 aa AA seqDB search
MRSEKRRSNKRSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDVNDAHHSHDM
MEMSGPDQDVGGHEHVHENSTIAERLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNK
LIFMSSAKDDELDAVALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVE
NMRYMLYPYSPETPVYFGCKFKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSD
NSGAEDVEIGKCLQNVNVLAGDSRDSNGRGRFFPFVPEHHLIPSHTDKKFWYWQYIFYKT
DEGLDCCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIINTPEALPNKLAVGELMPEIKEQ
VTESTSDGVSKRSAETKTQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgaaaaacgacgctcaaacaagcgatcatttgtgtccctgattgtgggcctg
atcgtgggcttctgcctggcggagctgttcgtctactccacgccggagcgaagtgaattc
atgccatacgatggccatcggcacggcgacgtgaacgatgcccatcacagccacgacatg
atggagatgtccgggccggaccaggatgtgggtggacacgagcacgtgcacgagaactcg
accattgcggagcgactgtacagcgaggtgcgggtgctctgctggatcatgaccaatccg
agcaaccatcagaagaaggcgcgccacgtgaagcgcacctggggcaagcggtgcaacaag
ctgatcttcatgagctccgccaaggacgacgagctggacgcagtggctctgcccgtgggc
gagggtcgcaacaatctgtggggcaagacgaaggaggcctacaagtacatctacgagcat
cacatcaacgacgccgactggttcctgaaggccgacgatgacacctacacgatagtggag
aacatgcgttacatgctgtatccgtacagtccggaaactccagtctacttcggctgcaag
ttcaagccgtacgtgaaacaaggctacatgtccggtggtgccggctacgttctcagccgg
gaggctgtgcgtcgctttgtggtcgaagccctgcccaatccgaagctgtgcaagtcggat
aactcgggcgctgaggacgtggagataggcaaatgcctgcagaatgtaaacgtgctcgct
ggggactcgcgagactcaaacggtcggggtcgcttctttccatttgtgcccgagcaccat
ctgatcccatcgcacacggacaagaagttctggtactggcagtacatcttctacaagacg
gatgagggtcttgactgctgctcggacaacgccatatcgttccactacgtctcccccaat
caaatgtatgtgctggactatctgatctaccatctgcgaccgtacgggatcataaacaca
cccgaagcattgcccaataagctggccgtgggcgaactgatgccggagatcaaggagcag
gtgacggaaagcacaagtgatggggtctccaagagatccgccgagacaaagacgcaataa

DBGET integrated database retrieval system