KEGG   Drosophila sechellia: Dsec_GM12747Help
Entry
Dsec_GM12747      CDS       T01064                                 

Definition
GM12747 gene product from transcript GM12747-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dsec_GM12747
Protein kinases [BR:dse01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dsec_GM12747
Spliceosome [BR:dse03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dsec_GM12747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2050 aa AA seqDB search
MSNELSELIALGCPDLAAQKPQGGSTQVELILNTERRLSIKQMTATDLATLRATAAAEAE
ARSRAQAEAEARAIAQEQLRQAREAESKARARAALEVQAQLQRVMESEKRRQQEEEERRS
RQQAEEEQEDDEDEDEEEELTKGSLPANSGPRERIASLPSNIDDAMEMHLLSVSQPKASS
KDDSPPKKSTSHIADSIELLRMQRAARDARSHNCSRERSISPDRNRERSAAPDRLQSSVS
MSSLDSASASASRQPSKAGSRRGSTTSTTGVEPPLMAAPPQPTKFPLTKTVSAPNMDRRR
SSLTSLFPGPSPLVAPEPSLHTNPDPRVQEQIEEDRRRRRMDDGYRDIPSGKMVHRTKTP
PPVGTNLGVSLKRVTAPSGSITIKPKESPMLGVVLRRVEKKTVPQKSILDDDKPLYHFSI
VRSDHKEHVPAQKPKPKPAPPAAKPSPGGILTGPQVIRNAPKQPVPAKPQRPMPGVPITI
TKIEGDKIIIIKKIIVPKNSKIPEQYLQVGRRRVGDRLVVSVVRLVFGVSLLLCFVRNLF
YRIYLDAASPSLRTKEESQPAMQKPTPPPAIGQQFFQVVSPQFASVLSSSIPESKCAVRS
PISSPLAIRKCRPPLLPASPKSTPPLPRKHHPLAYNAATGTISSASGAALPSRLMTTIAS
SPASSISLSSCSSPSSSPPPPVPCRAPKNASRPVAAPAAPPPSTSNEISLDKLLQQQQEL
EEKSAAATNSAKMDANFYDAEIEMMNKYLKSLPDYSELDRKLHQEFQECEDLYDKIKRQQ
QPLAKSNSQQSVTKAVGPGVPAISSGLSKSSSINFAQNPSSRGAAPRLAYPSIFSQAAGE
PKLQRSISSSNMPISAPTPMRPLPTKNGLQSGSNLSLNKQLMNEFWSENLTSSQKRQTPK
RTFWNYEKICGAQLGDAGQPFKVDAKTAKKLAIFDPTVAEAAQKELQRPQQSQVPQSQPH
RLQKNASLSHLDLKVRQAVTKDDLYKLICNEQSPLAGSNFVSRVPVKQQFPAQQQQVLPK
SMSMTHVPGGGQPMGAPLLRTSSRTHIPCYMKNLPSLSRSTSNSAILITQPRKEPPPKEP
LKAPAPLPAIADAAPTVGKPSGVLKSSSSSCVPSPRCAAAFFRRPQESNNPQQQHHQPLQ
KPQQVAPIEESGPGDSASLERKSEKSNSTLSTSSFTVTNCCTTHLPQLSKFTSSFHIAPN
TATTTAATATPTPTAAATTSDQQQQSGGAAAMVAANLEVPTSSSSSAATKRQKDVDNKLE
KCLNDMLKLKTSSNSNNTSNSNNNAIMSQSLTGEHKDPKTALEGPTSSSSSKYVGESQIP
VPVQLYDPQKPLLQQQQKQQRLCYPIGKSNSTSQLPMGGYQRLLQQQQQQQQQHHQQQHQ
EQQQYPQHKRPFLNWNSFACSAMNGASDPFMQQQHMPAHQQHLPHKLQQSYSSSHVPKQA
PKSGLAMFLQNNTNKENKFGQPMQQQPPGMMPQMYGYQAPQQQSKMGYPRTGAPLTHSAS
FSSAQRPTALQFHQQHQQQQQQQQHPQQQQQQHSSFGLGMMSRNYYNVPKQPERKPLQTF
DPYAYPKPNQMQPVKYQQQQQQPHPHTQFLNVSAAGGGGGAAGLQYDPNTNMQLFYASPP
SSSSNKQPQQPQQQQQQQSQLQQSNSVIFNHSGQQHQPHQQQQNEMSKSALGLHFIETAK
PVIQDDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEKY
REAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEP
YPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNT
DVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLF
QTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQ
LSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQPLSSGSS
SRERSHSLSR
NT seq 6153 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgaacttagcgaactgatcgcccttggctgtccagacctcgcggcacaaaag
ccgcagggcggtagcacccaggtggagttgatcctcaacactgagcgccgcctgagcata
aagcagatgacggccacggatttggccactctaagggcaacagcagccgcggaagcggag
gccagatctcgagcgcaagcggaggcggaagctcgagcaattgcccaggaacagttgcgc
caagcccgcgaggccgagtccaaggccagagcacgtgctgccctcgaggtgcaggcccag
ctgcagagggtgatggagagcgagaaacgcaggcaacaggaagaggaggaaaggcgcagc
aggcaacaagcagaggaggagcaggaggatgatgaagacgaggatgaggaagaggaactg
accaagggttcccttccagccaattcaggtccaagggaacgcattgcttcgctacccagc
aacatagatgatgccatggagatgcaccttctcagcgtttcgcagccgaaggcctcttcc
aaagatgactcaccgcctaagaagagtacctctcacatagcggactcaattgagctgctg
agaatgcagcgagctgctcgggatgcccgatcccacaattgcagtcgagagcggtcaatt
tctcctgatcgtaatcgcgaaaggagcgctgctccagatcgcctccagagttctgttagc
atgagcagtttggactcggccagtgcatcggcatccagacaacccagcaaggcaggcagt
cgacgtggtagcactacgagtaccaccggtgtggagcctccacttatggcagcacctcca
cagcctaccaaatttccactcactaagacggtgtcagcgcccaacatggaccgccggcgg
agcagtctgacatcgctcttccctgggccatcgccattggtggcacccgaaccatctctg
cacaccaatcccgatccaagggttcaagaacagattgaagaggatcgtcgtcgccggcga
atggacgatggttaccgtgacatacccagcggaaaaatggtgcatcgaacgaagacaccg
ccaccagtgggcactaaccttggagtgagcctcaagcgggtgacagcgcccagtggatcg
ataaccatcaagcccaaggagtcgcccatgctgggagtcgtactgcgtagagtggagaag
aaaactgtaccgcaaaagagcattctggacgacgataaaccactgtaccacttctccatt
gtgcgcagcgaccacaaggaacacgtgcctgctcagaaaccaaaacccaagcctgctcct
ccagctgctaaaccaagtcccggtggcatcctcactggaccccaagtaattcgaaatgct
cctaagcaacctgtgcccgcaaagccacagcgtcctatgcccggcgttcccatcactatc
acaaagatcgagggcgacaagattatcatcatcaagaagatcattgtgcctaagaacagt
aagataccggagcagtatctgcaggttggtcgtcgtcgtgttggtgatcgccttgtggtg
tctgtagttcgtctggtgtttggtgtctccctcctcttgtgttttgttcgaaatctgttt
tatagaatttacctcgatgccgcatcaccaagcctaagaacaaaagaggaatcccagcca
gctatgcagaaacctacgccgccgccggccattggccagcagttctttcaggtggtctcc
ccgcagttcgcctctgtgctatcatccagcatcccggagagcaagtgtgcggtgcgttct
ccgatatcctccccactagcaatccggaagtgtcgtccacctttgctgccggcgagtcca
aagtccactcctccactaccgagaaaacatcaccctctggcttacaacgcggcaacggga
acaatcagcagtgcctctggagcagcgttgccttcccggttaatgaccaccattgcctcc
agcccggcttctagtatatcgctgtcctcctgtagttcaccttcatcatctccaccaccg
ccagtaccatgtcgagctcctaagaatgccagtagacctgttgctgcgcctgctgcccca
cctccatccacctcgaacgaaatcagtttggacaagttgctgcaacagcagcaggagcta
gaggagaaatccgcggcagccacaaacagcgcaaaaatggatgcaaacttctacgatgcc
gagattgagatgatgaacaagtatcttaagagcctgcctgactacagcgaactggacaga
aagctgcaccaggagttccaggagtgcgaggatctctatgacaagatcaagcgtcagcag
cagccgctggccaagtccaattcgcagcaatcggtcacgaaggcagtaggaccaggagtg
cctgcgatctcctccggcttatccaagtcttcttcaattaacttcgcccagaatcccagc
agtcgtggagctgctccgcgtttggcctatccctcgatattttcccaggctgcaggcgaa
cccaagctgcagcgcagcatttcaagttctaatatgccaataagtgcacctactccaatg
cgcccgctgcccaccaagaatggcctgcaaagtggctccaatctgtcccttaacaaacag
ttgatgaacgaattctggagcgagaatctcaccagttctcaaaagcggcaaacgcctaag
cgaaccttttggaactacgagaagatctgtggtgcccagttgggcgatgcaggacaaccc
tttaaggtggatgcaaagactgccaagaaattggctatatttgatcccacagttgcggag
gccgctcagaaggagttgcaacgacctcagcagtcacaggtgccacaaagtcagccgcac
agactgcagaagaatgcctctttgtcgcacctggacctcaaggtgcgtcaggcggtgacc
aaggacgatctctataagctgatctgcaacgagcaatctccgttggcaggatcgaatttt
gtgagtagagtcccggtgaagcagcaatttccagcacagcagcaacaggtgcttccaaag
agcatgtccatgacgcatgtgccgggtggtggtcaacccatgggagctccattgctgcga
acttctagtcgcactcatataccctgctacatgaagaatctaccctctttgagcaggagc
acatcaaactctgcaatactcattacccaaccgcgaaaggaacctccaccaaaggaacct
ctgaaagctccagcaccacttcctgccatagctgatgctgcaccgactgtgggcaagcca
agtggcgtcctaaagagctccagcagttcctgtgtcccctcaccgcgttgtgccgctgcc
ttctttcgccgacctcaagaatctaacaatcctcagcagcaacatcaccagccacttcag
aaaccgcagcaagtggcgcccatcgaggaatccggacctggtgattccgcatctctggaa
cgaaaatcggagaagagcaatagcacgttaagcacaagcagctttacggtgaccaactgt
tgcacaacccacctgccgcagctctccaagttcacctcatcgttccatattgcccccaac
acagcaacaaccacagccgctacagcaacaccgaccccaacagcagctgcaacaacaagc
gatcagcagcagcaaagtggcggagcagcggccatggtggctgccaacttggaggtgcca
acatcgtcatcgtcttcagcggccacaaagcgccagaaagatgttgacaacaagctagaa
aaatgcttgaacgacatgctaaagttgaagaccagcagcaacagcaacaacactagtaac
agcaataataatgcaatcatgtcgcagtcgctgacgggcgagcacaaagacccgaagact
gcactcgaaggccccacgagcagcagcagtagcaagtacgtaggtgaatctcagatcccc
gtgccagttcagctgtacgatccgcagaagccgttgctgcagcaacagcagaagcaacaa
aggctctgctatcccataggcaaatctaactctacctctcagctgcccatgggcggctat
cagcgattgctgcaacagcagcagcagcagcagcaacaacatcaccaacagcaacatcaa
gaacagcagcagtatccgcagcacaagcgacccttcctcaactggaatagctttgcatgt
tccgccatgaacggagcgagtgatccctttatgcagcagcaacacatgcctgcccaccag
caacatctgccacataagctgcagcaatcatactcctcgtcgcatgtgccgaaacaggcg
cccaaatcaggactggccatgtttctgcagaataacaccaacaaggagaacaagtttggc
cagccgatgcagcagcagccacccggcatgatgccccagatgtacggataccaggcgccc
cagcagcaatccaagatgggctatccccgcaccggtgccccactgacgcactcggcctcc
ttcagctccgcccaaaggccgacggccctgcagttccaccagcaacatcagcagcagcag
caacagcagcaacacccccagcagcaacaacagcagcattccagctttgggctgggcatg
atgagtaggaattactataatgtgcccaagcagccagagcgcaagccgctgcagaccttc
gatccgtatgcctatcccaagccgaatcagatgcagccggtcaagtaccagcagcagcag
cagcaaccgcatccgcatacgcagtttctgaatgtttccgctgcaggaggcggcggcggt
gccgctgggcttcaatacgatccaaatacaaatatgcaattgttttacgcgtcgccaccg
tcatcgtcatcgaacaagcaaccgcagcaaccgcaacagcaacagcagcagcagtcgcag
ctacaacaaagcaattctgtcatattcaatcactcaggccagcaacaccaaccacatcaa
cagcagcagaatgaaatgtccaagtccgcattggggctgcacttcatcgagacagcaaag
cccgtcattcaagatgatgctgatggtcacttaatttaccacaccggagacattctccat
cacagatataagatcatggccacactgggcgagggaacttttggacgtgtggtcaaggtc
aaagatatggagcgtgattactgtatggctttaaagattataaagaacgtggaaaagtac
cgcgaagctgccaagctggagataaatgctttggaaaagattgcccaaaaggatccgcat
tgtgatcatttgtgcgtgaaaatgattgactggtttgattatcatggacacatgtgtata
gtttttgaaatgttggggctcagtgttttcgattttttgcgagagaacaactatgagcca
tacccgctggaccaagtgcgccatatggcctatcaattatgctactctgtgaaatttcta
catgacaatcgtttaacgcacacagatctcaagccggagaacattctcttcgtcgactcg
gattatacttctcactataatcataagattaaccgcgaggtgcgccgcgtcaagaacacg
gacgttcgcctaatcgacttcgggtcggccaccttcgaccacgagcaccacagcacaatt
gtctcgacgcgacattaccgcgcgcctgaggtcatactggagctggggtggtcacagccg
tgtgacgtttggtccattgggtgcatcttgttcgaactgtatctgggaatcacgctcttc
caaacgcacgacaatcgcgagcacctggccatgatggagcgaatcttgggacaaatacca
tatcgcatggcacgcaaaaccaaaacaaagtacttctatcatggtaagttggattgggat
gagaagtccagtgcgggtcgctacgtccgtgatcactgcaagccgttgttcctgtgccag
ctgagcgacagcgaggaccactgtgagctcttcagtctgatcaagaagatgttggagtac
gagccctcgtcacgcatcacgttaggtgaggccctgcatcatccgttcttcgataggctg
ccaccgcaccatcgagtgggtgaggtcagcaacaagcagcccctttcgtcgggcagcagc
agccgcgaacggtcgcatagcctctccagatga

DBGET integrated database retrieval system