KEGG   Drosophila sechellia: Dsec_GM12771Help
Entry
Dsec_GM12771      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM12771-PA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dse  Drosophila sechellia
Pathway
dse00010  Glycolysis / Gluconeogenesis
dse00260  Glycine, serine and threonine metabolism
dse01100  Metabolic pathways
dse01200  Carbon metabolism
dse01230  Biosynthesis of amino acids
Module
dse_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dse_M00002  Glycolysis, core module involving three-carbon compounds
dse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dsec_GM12771
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dsec_GM12771
Enzymes [BR:dse01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dsec_GM12771
Membrane trafficking [BR:dse04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dsec_GM12771
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dsec_GM12771
  Exosomal proteins of melanoma cells
   Dsec_GM12771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 6612663
NCBI-ProteinID: XP_002037167
FlyBase: FBgn0167707
UniProt: B4HZ69
AA seq 255 aa AA seqDB search
MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKEAGLEFDVAHTSV
LTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSF
DTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEG
KRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEET
VKKAIEAVAAQGKAK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcaagtacaagatcgtgatggtgcgccacggcgagtccgagtggaaccagaag
aatcagttctgcggctggtacgacgccaacctcagcgaaaagggtcaggaggaggctcta
gccgccggcaaggccgtcaaggaggccggcctggagttcgatgtggcccacacctcggtg
ctgacccgcgcccaggtgacgctggctagcatcctgaaggccagtggccacaaggagatc
cccatccagaagacctggcgcctgaacgagcgccactacggtggactcactggcctgaac
aaggccgagaccgccgccaagtacggcgaggcccaggtgcagatctggcgtcgcagcttc
gacaccccgccaccaccgatggagccgggtcatccgtactacgagaacatcgtgaaggat
ccccgctatgccgagggtcccaagccggaagagttcccccagttcgagtctctcaagctg
accatcgagcgcacactgccctactggaacgacgtcatcattccccagatgaaggagggc
aagcgcatcctgatcgccgcccacggcaacagcctccgtggcatcgtcaagcatttagac
aacctctctgaggacgccatcatggccctgaacctgcccacgggcattccgttcgtctac
gagctggacgagaacttcaagccggtggtgtcgatgcagttcctcggcgacgaggagacc
gtgaaaaaggccatcgaggccgttgccgcccagggcaaggccaagtaa

DBGET integrated database retrieval system