KEGG   Drosophila sechellia: Dsec_GM12779Help
Entry
Dsec_GM12779      CDS       T01064                                 

Definition
GM12779 gene product from transcript GM12779-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dsec_GM12779
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM12779
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM12779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1077 aa AA seqDB search
MLLHQYMHEYDVNERKEEPASLPPTQNDTTDTEINSQLLEDQRNQEQDNSQPPQENSINQ
QEKDTLHVSVLYPLVVSAQLADSQPILTANSPKLSPVKKRQRRVYVADTSRCYSLRSRQE
PATKAPLEGDLKQPDVAPPPPPLQAPSPTPTESTEYTPSELFKPEFWNRIEEVQEAKPVG
KKRRTAGGLKRTRGNKLLRELEIQSPETAAAIAAAQAELNAAGKSGAAGARSSRKRTNTM
SLYDRRFQTTTEERRVANGYGGNAARSVTGSSSNEIESQETQSHQYYGPNGGSSAAGAGA
GLNGSAAALNHAPSMGTLCNIGNSCYLNSVVYTLRFAPHFLHSLHHLIQDLNVVQQTIVR
QQTARSASLGRNVSAAQLEHARSWSSKDLATSTDQYSGQNGGVNSGNGGSGSSKSTHQSV
TEKLHELYNNLHGNEMADSTEPYHADTLLHAIQDVNATFEGNQQQDAHEFLMCVLNCIRE
TNQSLIKAIGECPEVIANGYIANPDEVETGEGQDRTDSTASQNLNAGNGSLATSQTTTTK
TSFFSRKSKRKDEVKSSKSTRVQSPLKESSPTAGGITGAGTAHATANSLFYLNTVDLSGA
SRTSGSASTSASGVVATSAALPTPPQATKYSSDDEINSATVLKDKMRLEERIRELNLNFF
SSDFEGIVVLTTKCLSCETITRQKQGMLDISVPVPISGYDNADLQDKPSTYIQNSCITKE
YFRGENKYSCNQCTGYTEAIRSISYEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLPCFC
ATCCELGEGNKLHVYKLYSVITHVGATLTVGHYIAYTCFLDLASDYVNCPKDRRNTMTNS
QTMASQAVPSNENAAPNNGSSSVASTPVIAAASALASSGNILMKKMKFGRSKASSSGDMS
KNVKQVNGITSKNITNGIGKLSISTTCQGVNCCAMRLCCSQQTSSSNSASCSDFSEESLQ
NGSNSNLSFGGSGSTYPTGYGSTGRGGVRANYAHGGPDPIWYMCDDDKIKAMTQREFEEL
LSPTRKITITPYLLFYARFDLQPQKATPPKPGSTPPPPSSAQSSWSNENVPSGSHKI
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgttgctccaccaatatatgcacgaatatgacgtaaatgagcgcaaagaggaaccagcc
agtcttccacccacacaaaacgacaccactgacactgaaatcaacagtcagctactagag
gatcagcgaaatcaggaacaggataacagccagccgcctcaggaaaattcaattaatcag
caggagaaggacacattgcatgtttccgtgctttatcctctggtagtctccgcgcagctg
gcagacagtcaaccgattctgactgcgaactcgccgaagctatctccagttaaaaagcgt
cagcggcgcgtttatgttgcggacacctcgcgctgttacagtctacgttcccggcaagag
cccgcgaccaaggccccactcgaaggcgacctaaagcagcccgacgtcgctccaccacct
ccgcctcttcaggcgccatcgcccacgcccacagagtccacagaatacacaccttcagaa
ctatttaaaccggagttctggaaccgcattgaggaggtccaagaagcaaagcccgttggg
aagaagcgccgaaccgctggaggactcaaaagaacgcggggcaacaagcttctgagagag
cttgagatccaatcgccggaaacggcggccgctattgcggcagcacaggctgaactcaac
gccgccggaaagtcgggagcagcaggagcgcggtccagccgcaagaggaccaacacgatg
tctctatacgatcggcgattccagaccaccaccgaggagcgccgcgtggctaacgggtac
ggaggcaatgctgcgcgatcggtcactggctcctcgtcaaacgagatcgagtcccaggag
acgcagagccatcagtattatggtcccaacggcggcagcagtgccgcaggagcaggcgca
ggcttgaacggaagtgcggcggccctgaaccatgccccttccatgggcacactgtgcaac
attggcaacagttgctacttgaattcggtggtttacaccctgcgctttgccccgcacttt
ttgcacagcctacaccacctgatacaggacttgaatgttgtgcagcagacgatagtccgc
caacaaacggccaggtccgcgtccctcggcaggaatgtgagtgccgctcagttggagcac
gcccgcagctggagcagcaaggatctggccaccagtacggatcagtacagcggtcagaac
ggcggagttaatagcggaaacggtggcagcggttcgagcaagtcgactcatcagtcggta
accgaaaaactccacgaactgtataacaacctgcacggcaacgagatggcagactccacg
gagccctaccacgcggacacgctgctgcacgccatccaggacgtaaacgccacctttgaa
ggcaaccagcagcaggacgcacacgaattcctaatgtgcgtgcttaattgcatcagggaa
acgaatcagtctttgatcaaggccattggcgaatgtcctgaggtcatcgcaaatgggtac
atagccaacccggatgaggtcgaaaccggagagggccaggatcgcactgattcgactgcg
tcgcagaacctgaacgctggcaatggatcgctggcaactagtcaaacaaccacgaccaaa
acgtcgttcttctctcgcaaatcaaaaagaaaagacgaggtcaagtcatccaagtcgacg
cgcgttcagtcgccactcaaggagagtagtcccacggcgggcgggataaccggtgctggc
acagcccatgccaccgctaacagcctgttctatctgaacacagttgatctcagcggcgcc
agcagaaccagcggaagtgccagtacgagtgcgagtggcgtggttgccacaagtgcagct
ttgcccacaccaccacaggctacaaaatactccagtgacgacgagattaattccgccacc
gtgctgaaggacaaaatgcggctggaggagcgaatacgggaactcaacctgaacttcttc
agctcggacttcgaaggcattgtggtgctgaccaccaagtgcctcagttgcgagacgatc
acgcggcaaaagcagggcatgcttgatatttccgtgccggtgccgatctcggggtacgac
aatgccgatctccaagacaaaccgagcacctatatacagaattcctgcattacgaaagag
tatttccgtggggagaataaatatagttgcaaccagtgcaccggctacaccgaagccatc
cgctccatctcgtacgaggtgctgccgcggttactggtcattcagctgaatcgattctct
ggcggcatggagaaggtgagtacgtacgtgccgaccaccttcactctgccctgtttctgt
gccacctgctgtgagctgggcgagggcaacaagctgcacgtttacaagctgtacagcgtg
atcacgcatgtgggagccaccctgacggtgggccactacatcgcgtatacgtgcttcttg
gatctcgccagtgactatgtcaactgccctaaggatcgcaggaatacgatgacgaactcg
caaacgatggcttcgcaagcagtgccctccaatgagaatgctgcgccaaacaatggtagc
agctccgtggccagcactccagtcattgcagcagcttcggctttggcctcctcgggcaac
attttgatgaagaagatgaagttcggtcgcagcaaggcctccagcagcggtgatatgagc
aagaacgttaagcaggttaatgggataaccagcaagaacatcaccaatggaattggcaag
ctgagcataagcaccacctgccagggagtcaactgctgtgccatgagactgtgttgtagc
cagcagacgagcagcagcaactcggccagttgcagcgatttcagcgaggagtccctgcaa
aatggaagcaacagcaatctcagcttcggaggatcgggcagcacatatcccacgggctac
ggaagcacgggtcgcggtggtgtcagagccaactacgcccacggaggtcctgatcccatt
tggtatatgtgcgacgacgacaagatcaaggccatgacccaaagggagttcgaagagctg
ctttcgcccacgcgtaagatcacaataacgccctatttgctcttttacgcgcgattcgat
ctgcagccgcaaaaggcgacgccgccgaagcctggatcaacgcctccgccaccgtcatcg
gcacagagttcgtggtcgaatgaaaacgtgcccagcggctcgcacaaaatttga

DBGET integrated database retrieval system