KEGG   Drosophila sechellia: Dsec_GM12826Help
Entry
Dsec_GM12826      CDS       T01064                                 

Definition
GM12826 gene product from transcript GM12826-RA
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dse  Drosophila sechellia
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dse00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 306 aa AA seqDB search
MAATAPVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIAS
LAQKFPTVKIIGEEGGSDLNVCDDWLVNELDEGFLQQSCPAEWKDVKPEDFVIWVDPLDG
TAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAVP
APAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCK
KWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKIPAEVR
AAVRAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactgctccagtaataatgcgcgtcatggcgtcatcgatcagcacagccaag
cgggcgggcggcataatccgcgacgtgctcaagaagggcgacctgggcatagtggacaag
ggaaagaacgacccgcagacggaggcagatcgctctgcccagcgctgcatcatcgcctcc
ttggcccaaaagttccccaccgttaagatcatcggcgaggaaggtggatccgatctgaat
gtctgcgacgactggctggtaaacgagttggatgagggattcctacagcaaagttgccca
gctgagtggaaggatgtgaagcccgaagactttgtcatatgggtagatcccctggacggc
acagcggaatatacacagggacacgtggaacacgtgaccgtcctgatcggcatagccgtg
aaggatgctgctgtgggcggcatcattcatcagcccttctaccaacagcccgatggcgaa
atgggtcgcaccatttggggtctaaagggtctgggcacgggaggattcacggcggtgccc
gcgccagccggccagttcatcataaccaccactcgctcgcattccaatgccctgcatcaa
caagcactcaacgcattcgcatccacagaagttctgaaagtcggcggcgctgggttcaaa
gtgctccagctgctggagggaaaggcccacgcctacgtcttcgccacgccgggctgcaag
aagtgggacacctgcgcacccgaggccgttctggaggcccagggcggctgtctcaccaac
atcaacggcgagcactacgcctacaatgcggatgtggagcacgtgaatcgccagggagtg
ctggccagcctgggacaggaccatgccgcgctggtcgaaaaaattcccgccgaggtgcgg
gcggcagtgagagccaagtga

DBGET integrated database retrieval system