KEGG   Drosophila sechellia: Dsec_GM13080Help
Entry
Dsec_GM13080      CDS       T01064                                 

Definition
GM13080 gene product from transcript GM13080-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dse  Drosophila sechellia
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dse00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 656 aa AA seqDB search
MTANTATSEENLLGKGGQPHEPSTPTSDTEVGGGTPTELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETDEDDHIYEQLIRIDDIIGSRYGPRLKKRARGGLNSCRNPNVPGQEADPE
PDSDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYGVNLQTAELWHHTIRRHKRGNG
SSSPADCGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRT
RRDLLERYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLAKSVAHH
CNEPYEPKPILHATLTCMAGKSTPMDVVRVELAPRDKHFVMYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRLSYLLAKGKKEPPVEAAKEAREMPAESDQPKRP
STAVAIRSSLPLNAGEFHDLPEEEEVEEVEEEAVLDGEQFADAISLDRSVYRQHADSWHS
AMSRRTAYYSLGGPSMRSNRSRMSISQRIEAANAEFAERVPTGTIPGLQMPLPSSEGWIC
EDGDFVMVHAAYTTHLSSDVFFAPESRLDDGLIYLVIIRSGVSRHQLLNFMLSLNTGTHL
PIGEDPFIKVVPCRAFRIEPSSSDGILVVDGERVEYGPIQAEVMPGLINVMTTSGQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacacagcgacgtcggaggaaaatctgctgggaaaaggtggacagccgcat
gagccctccacgcccacctcggatacggaagtgggcggcggcacgcccacggaactgagc
gagatcttcttcgtagacaacagtcggcgcaagcagagcatcaaaatccaggtgaaactg
tgtccggaaggcgtttacctgcgtcgcgaaaccgacgaagatgaccacatctatgagcag
ctgatcaggatcgatgatatcataggttcgcgctacggaccgcgtttgaagaaacgagcc
cggggcggtctaaactcctgccgcaatccaaatgttccgggccaggaggcggatccggaa
ccggatagcgataatagcgcctacttgtacatctatgcgtacttgaagaaggagaaaccg
ttgcggcgtgtccaaacgctcaggattctacgctttcgttcgagcaatgactatggggtg
aatctacagaccgccgagttgtggcatcatacgattcgaaggcacaagcgtggcaatggc
agcagttcgcccgccgattgtggcaaacagttgctcatcctactgaatccgaaatccggt
tcgggcaaggggcgtgagctcttccagaaacaagtggcacccttgctgacggaagcagag
gtgcaatacgatctccagatcaccacacatccgcagtacgccaaagagttcgtgcggacc
aggagggatctgctggaacgctattcgggcattgtggttgcctccggcgatggtctgttc
tacgaagtgctcaatgggctgatggagcgcatggattggcgccgagcctgcagggagctg
ccgcttggcatcataccatgtggctccgggaatggtctggccaaaagtgtggcccatcac
tgcaacgaaccgtacgaaccgaagcccattctccatgccaccttgacctgcatggcgggc
aaaagtacacccatggatgtggtccgagtggagctggcaccgcgggacaagcactttgtg
atgtactccttcttgtcggtgggctggggtctgatagccgacatcgatatagagagcgag
cgattgagatcgattggagcgcaaaggtttacgctgtgggccatcaagcgattaatcggg
ctgcgcagctacaagggacgattgtcctatctactggccaagggcaagaaggaaccacca
gtggaagcggcaaaggaggcgcgagagatgcctgcagaatcagaccaaccgaagcgaccg
tcaaccgctgttgcaatccgttcatctctgcctctgaatgccggggaattccatgatcta
cccgaggaggaggaggtggaggaggtggaggaggaggcggttttggatggagaacagttc
gccgatgccatatccctggatcgttcggtttatcgccagcatgccgacagttggcactcg
gccatgtccaggcgaacggcatattactccctgggcggacccagcatgcgatccaatcgc
agccggatgagcattagccagcggatcgaggcggccaatgcggaattcgctgagagggtg
ccaacgggcaccattccgggattacagatgccactgcccagcagcgagggttggatctgc
gaggatggtgactttgtgatggtccatgccgcctatacgacccatctctcctccgacgtt
ttctttgcgcccgaatcccgtctggacgatggcctcatatacctggttatcatccggagt
ggcgttagtcgccatcagctgctcaatttcatgctgagcctaaacacaggcacccatctg
cccatcggcgaggatccgttcatcaaggtggtgccctgtcgggcattccgcatcgagccg
agcagctccgatggcatcctggtggtggacggcgagcgggtggaatacggacccattcag
gcggaggttatgcccggcctgatcaatgtgatgaccaccagtggtcagtag

DBGET integrated database retrieval system