KEGG   Drosophila sechellia: Dsec_GM13135Help
Entry
Dsec_GM13135      CDS       T01064                                 

Definition
GM13135 gene product from transcript GM13135-RA
Orthology
K11252  
histone H2B
Organism
dse  Drosophila sechellia
Brite
Exosome [BR:dse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dsec_GM13135
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKNDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaacgacaagaaaaagaaacgcaagaggaaggagagttatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggaatttcgtcgaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgaattgctgccgaagcgtctcgtctggctcac
tacaacaagcgctcgaccatcaccagtcgggaaatccaaacggctgttcgcctgcttctg
cctggagagttggccaagcatgctgtcagtgagggaaccaaggctgttaccaagtacacc
agctccaaataa

DBGET integrated database retrieval system