KEGG   Drosophila sechellia: Dsec_GM13220Help
Entry
Dsec_GM13220      CDS       T01064                                 

Definition
GM13220 gene product from transcript GM13220-RA
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Brite
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM13220
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dsec_GM13220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 340 aa AA seqDB search
MDTDNPGQATVEAVTAKGATAANNWCLIESDPGVFTEMISGFGCTGAQVEEIWSMNADAF
RHLEPIHGLIFLFKWLDNMPAGRVVTDRSDIFFARQVVTNACATQALICLLLNLQHEDID
LGPILSELKIFCQDLCPESRGQCLAKEEKIRKVHNSFARPELFVVEDSADSEDVDCYHFV
GFMPIKGKLYELDGMKEGPIELGEIGQQQNWLDVVRPIIEERMKRYSVGEIHFNLMALVS
DRQRCYERQIQMLVELSSPLSYADCQAEIATLIYFVKLEKEKKRRYRKENNRRRHNYLPF
IVELLKQLGETGQLMAICDKAKDRSCPSKSNKDAMDQQPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggacacagacaatcctggacaagcaaccgtcgaggcggtcaccgccaaaggggcaacc
gccgcaaacaactggtgcctgattgaaagcgatccgggggtcttcaccgagatgattagt
ggttttggctgcacgggtgcccaggtggaggagatctggtccatgaatgcagacgccttt
cgtcacctggagcccatccatggtctgatctttctgttcaaatggttggacaacatgccc
gctggtcgcgtggtcacggataggagtgacatcttctttgctcgccaggtggtaacgaat
gcctgtgccacacaggctctcatctgcctgctgctcaatctccagcatgaagacatcgat
ttgggtccaattttgagcgaattgaagatcttctgccaggatctgtgtccggaatcccgt
ggacaatgcttggccaaagaggaaaagatccgtaaggtacacaattcctttgctcgaccc
gaactctttgtggttgaagacagtgcggattcggaagacgtagattgttaccactttgtg
ggctttatgccaataaaaggcaaactttacgaattggacggaatgaaagagggtcccatc
gagctcggcgagatcggccagcaacagaactggctggatgtggtcagaccgattattgag
gaacgcatgaagcgctacagcgttggagagatccacttcaatctgatggccctggtctcg
gatcgtcagcgatgctacgagcggcagatccaaatgctggtcgaactatcatcgccgctg
agctacgcggattgtcaggcggagatcgccacccttatatactttgtgaaactcgagaag
gagaagaagcgccgctaccgcaaggagaacaatcgtcgtcgccacaattatctgccattc
atcgttgagctactgaagcagctgggcgagactggccaattgatggccatttgcgacaag
gccaaggatcggtcttgtccatctaagtcgaacaaagacgctatggaccaacaacctcaa
taa

DBGET integrated database retrieval system