KEGG   Drosophila sechellia: Dsec_GM13227Help
Entry
Dsec_GM13227      CDS       T01064                                 

Definition
GM13227 gene product from transcript GM13227-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
dse  Drosophila sechellia
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dse00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dsec_GM13227
Enzymes [BR:dse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dsec_GM13227
Peptidases [BR:dse01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dsec_GM13227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1129 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQTQQQRNSPPQLPKFKNLIQPQLHAVGAVTQL
PSENGNMPPQQLLADSSSTSFGDGEAMGIDDESKEDQFRSETTFSFTVENVVQLKSQRLS
PPVFVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKPDAQPFTRAR
IKHLFYSKENDYGYSNFITWQELKDSEKSYVHNNSITLEVHVVADAPHGVLWDSKKHTGY
VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSAKSVGLSLQRVFHELQFGDRP
VGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIK
CKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGLQEASKGV
IFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEQINLDRYLAESENTLADYVLHAVL
VHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISFHAKCSNA
YMLVYIRQSELDRVLGDITESEISSDLVERLDLEKRIEMARRKERGEANTYVSVHVILEE
NFEEQHKRRLFDLEKVHPRVFRIKQNQTVDELVDMFVRGFGVSRQRMRMWNLCTAQTQKF
LHFDFVAEGSRTIEQISTSVDSWVIWLQLAWTDVPGPLPPFNPKTEALLFIKYYDPRNKR
LNYIGCTQQPHTRRLIDLVPDVNSKLGFDPDTELTIYDEYADKKLVNLNEPIESALFIPQ
DHLQGHILIFERENVDAKLDLPTVGDYFLDLVYRIEIIFSDKCNPNEPDFTLELSNRYNY
DQLANAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKQSSTKRIFY
QRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKISFAENSRR
KLRLMKISNHKIVAVCKDDIPLDTLLKSNESITTTQGAQKTFRIEEVPAEEMQLAENEFL
IPVAHFSKELYNSFGIPFLTKARHGEPYGAVKQRIQRRLNVQDKEWENYKFCVISMGHSV
DVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcagtctattgaagcaatggacacccaggacacccaagaggtc
gagatcctcaccagtgaccttcaacagacacaacagcagcggaattcaccgcctcaattg
ccgaaattcaagaatcttatccagccacaattgcacgccgttggtgcagtgacccaattg
cccagcgagaacggcaatatgccgccacaacaactattggcagatagtagctccacttcg
ttcggcgacggcgaggccatgggcattgacgatgagtccaaggaggatcagttccgatcg
gagaccacattctcctttaccgtcgagaatgtggtacaattgaaatcgcagagactgtcg
ccgccagtgtttgttcgcatgctgccatggaggataatggtcatacccaatgatcgtgcg
ctcggcttctttctgcagtgcaatggggagaatgattcgcccacctggtcgtgcaatgcc
attgccgagctgcgtttgaagtgccacaagccggatgcacagcctttcacgcgtgcccgc
attaagcatttgttctactccaaggagaatgactatggctactcgaatttcatcacctgg
caggagctgaaggattccgaaaagagctatgtgcacaacaacagcatcaccctggaggtt
cacgtcgttgcggatgcaccgcatggcgttctgtgggactccaagaagcacacaggctat
gttggccttaaaaaccaaggcgccacttgctatatgaactcgctgctgcagacattgtac
ttcaccaattcgctaagactgtctgtttatcgcatacccacggaggctgacgatagtgcc
aaatcagttggattatcgctgcagcgtgtgttccatgaactgcagttcggtgaccgtccc
gttggcaccaagaagctaaccaagtcctttggctgggaaacgctcgattcgttcatgcag
cacgatgtccaggagtttctgcgcgtgctgctcgacaagctcgagtcgaagatgaagggc
accatcctggagggcaccataccgggtctgttcgagggaaaaatgtcgtcgtacatcaag
tgcaagaatgtcgactacaacagcacacgttacgagacgttctacgacatccagctgaac
atcaaggataagaagaatatctacgagtctttccaggattacgtagctcccgaaacgctg
gagggtgacaacaaatacgatgctggtgtgcatggcttgcaggaagccagcaagggtgtc
atcttcacttcattcccacccgttttgcatctgcacctgatgcgcttccagtacgatccc
gtcacggacagctcgatcaagtacaacgatcgcttcgagttctacgaacagatcaatctg
gatcgctacctggccgagagcgagaataccttggcggactacgttctgcacgccgtgctg
gtgcactcgggcgataaccatggcgggcactatgtggtcttcattaatccaaaggctgac
ggacgttggtttaagttcgacgacgatgtggtctccagttgccgcaagcaggaggcaatc
gaacagaactacggcggcatggacgacgagatctcgttccacgccaagtgcagcaatgcc
tatatgctggtctacatccgccagtcggagttggatcgcgtactcggcgacataacggag
agcgagatatcaagcgatctggtggagcgtctcgatctggagaagcgcatcgaaatggcg
cgccgcaaggagcgcggcgaggccaacacctatgtgtccgtgcacgtgatcctcgaggag
aacttcgaggagcagcacaagcgtcgtctcttcgatctggagaaggtccatccgcgcgtc
ttccgcatcaaacaaaatcagactgtcgacgagctggtggacatgttcgttaggggtttc
ggtgtgtcgcgccaacgcatgcgcatgtggaacttgtgcaccgcccagacgcaaaagttc
ttgcatttcgatttcgtggcggagggatcgcgcaccatcgagcagatatcaacgtcagtg
gattcgtgggtcatctggctgcagctggcctggacggatgtacctggtcccctgccgccc
tttaatcccaagaccgaagccctgctgttcatcaagtactatgatccgcgcaacaagcgt
ctcaattacattggatgtacccagcagccgcacacccgccgtctcattgatctggtgccg
gatgtgaatagcaaattgggtttcgatccggacaccgagctgaccatctacgatgagtac
gccgacaagaagctggtcaatctgaacgagccgatcgagagtgcgctgttcataccgcag
gatcatctgcaaggtcacatcctaatcttcgagcgcgaaaacgttgacgccaaactcgac
ctgcccacggttggggattacttcctggatctggtctatcgcattgagatcatcttcagc
gacaaatgcaatcccaatgagccggactttacgctggagctgtccaatcgctataactac
gatcagctggccaatgcggtggccgagcgcttgaacaccgatccacagaagctgcagttc
ttcatgtgcatcaacaactacaaggagacggcgggcaatgccgtgccctacacatttaag
ggcacaatcaaggatctggtttcttacaccaaacagagctcaacgaagcgtatcttctat
caacgactgtcgctcagcattcacgagctggacaacaagaagcagttcaagtgcgtctgg
gtgagcagcgacctcaaggacgagaaggagctggtcctgtaccccaacaagaacgatacg
gttaagggactgctggaggaggcggccaagaaaatctcgtttgcggagaacagccgtcgc
aagttgcgcctgatgaagattagcaatcataagattgtggcggtatgcaaggacgatata
ccgctggatacgctgctaaagtccaacgagtccataacgaccacacagggcgctcaaaag
acttttcgcatcgaggaggtgccggcggaggaaatgcaattggcggagaacgagttcctc
atcccagtggcccatttcagcaaggagctgtacaactcattcggcatacccttcctaacc
aaggcgcgccacggcgagccgtacggtgcggtcaagcagcgcatccagcgtcgtctgaat
gtgcaggacaaggagtgggaaaactacaaattctgtgtgatctccatgggccacagtgtg
gatgtgaacgacaatacgcccgttgatctggaggtgtatcgctcgtggaccagcggccag
ttgcccttctttggcttggatcacatcaataagtcgcgcaagcgcagctcgcttaacttc
tccgagaaggccatcaagatatacaactaa

DBGET integrated database retrieval system