KEGG   Drosophila sechellia: Dsec_GM13694Help
Entry
Dsec_GM13694      CDS       T01064                                 

Definition
GM13694 gene product from transcript GM13694-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dse  Drosophila sechellia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dsec_GM13694
Enzymes [BR:dse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dsec_GM13694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 277 aa AA seqDB search
MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLEELRAKLQNPDKYAG
IIFTSPRCVEAVAASLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARA
LGDYIVDTFDGSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVER
ALEIYGESIEFLAFFSPSGFNCALQYFTSRQLSMDKWKLVAIGPSTRRALESLGQKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERMAALENNN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcgccagcgaactgtgatcatattcaaatcggagtcggaaagcagcgatgtg
tacgcggaaacgctggagaagcacgatttcaaccctgtgttcgtgcccacactgagcttt
ggcttcaagaatctggaggagctgcgcgccaagctccagaatccggacaaatatgccggc
atcatattcacatcgccgcgctgcgtggaggcggtggctgcgtccctgaatctcggcgag
ctgcccggcggttggaagatgttgcataactatgccgtcggcgaggtgacccacaatctg
gcgctgagcaccttggaccagctattcacccacggcaaacagacgggcaatgcccgggca
ctgggcgactacatagtggatacgttcgatggatcgcgggccctgccgctgctgctgccg
tgcggcaatctggccaccgatacgctgctctccaagctggccgagaatggcttctccgtg
gacgcgtgcgaggtgtacgagacgcgctgccaccccgaactgggcgccaatgtggagcgg
gcactggagatctacggcgagtcgatcgaattccttgccttcttctcgccatcgggcttt
aattgtgcgctgcagtacttcaccagccgccagctgtcgatggacaagtggaagctggtg
gccatcgggccgagcacccggcgtgccctcgaatcgctgggccagaaggtctactgcacc
gccgagcggccgacggtggagcatctggtcaaggtgctgctcaatccgcaggacagccgg
gagcggctgctcaaggagcgcgagcggatggccgccctcgagaataacaattaa

DBGET integrated database retrieval system