KEGG   Drosophila sechellia: Dsec_GM13781Help
Entry
Dsec_GM13781      CDS       T01064                                 

Definition
(RefSeq) Dsec\GM13781-PA
  KO
K03350  anaphase-promoting complex subunit 3
Organism
dse  Drosophila sechellia
Pathway
dse04120  Ubiquitin mediated proteolysis
Module
dse_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    Dsec_GM13781
Protein phosphatases and associated proteins [BR:dse01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dsec_GM13781
Ubiquitin system [BR:dse04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     Dsec_GM13781
Chromosome and associated proteins [BR:dse03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    Dsec_GM13781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC3 TPR_2 TPR_8 TPR_1 TPR_16 TPR_14 SRP_TPR_like
Motif
Other DBs
NCBI-GeneID: 6611115
NCBI-ProteinID: XP_002035672
FlyBase: FBgn0168712
UniProt: B4HV37
AA seq 328 aa AA seqDB search
MMIQEPVQAAIWHCLNYYDFKDAVFLSERLCSEVESDETIFLLATSYFRSNQVHQAYWLL
KEKARRSPQCRFLQAKCAYELKKYAEAESSLISTGFADAKNCDELQRDFGDLACFAYQLM
AQICMRTERNKLAVSALRRALKLNPFMWHAFADLCLLGQDTDAATIFQIHSTDVFNTCQG
SSVNANAMVLFGAEQHSQQHQERQSLITNLSNVSNYILTTPVDQQQQQINQNQNQHHNSN
MVTPINNNNNNNNLNSSISMLRGGLVQNSSMLAMLEDTPMGAPQDTAGPVSAEPAALRHE
QRHSVPQTVQIPIGHLTANSELRHHAFN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgattcaagagcccgtgcaggccgccatatggcattgcctgaattactacgacttc
aaggatgccgttttcctgtcggaacgactgtgctcagaagtggagagcgacgagacgata
ttcctgctggccaccagctacttccgctccaatcaggtgcaccaggcatactggctgctc
aaggagaaggcacgccgctcgccgcagtgccgctttctgcaagccaaatgcgcctacgag
ctgaagaaatacgccgaggcagagagctccctaatctccacaggattcgcggacgccaag
aactgcgatgagctgcagcgggacttcggagatctggcctgcttcgcctatcagctgatg
gcccagatctgcatgaggaccgagcgcaataaactggccgtcagtgctttaagacgcgcc
ctcaagctgaaccccttcatgtggcacgcattcgcggatctgtgcctgctgggccaggac
acagatgcggcgaccatattccagatccacagcacagatgtgttcaatacctgccagggc
agcagcgtaaatgccaatgcaatggtgctgttcggcgccgagcagcatagtcaacagcat
caggagcgccagtcgctgatcaccaacctaagcaatgtatccaactacattctaaccacg
cccgtggatcagcagcaacaacagatcaaccagaatcagaaccagcaccacaacagcaac
atggtgacgcccatcaacaataataataataacaataatctcaatagttcgatcagcatg
ctgcgcggcggcttggtgcaaaactctagcatgctggcgatgctggaggacacacctatg
ggggctccgcaggacacggccgggccagtatcagcagaaccagcagctctacgacatgag
cagcggcactccgttccgcaaacagttcaaatacctatcggccatctcaccgccaactcc
gagcttcggcatcatgcctttaactag

DBGET integrated database retrieval system