KEGG   Drosophila sechellia: Dsec_GM13832Help
Entry
Dsec_GM13832      CDS       T01064                                 

Definition
GM13832 gene product from transcript GM13832-RA
Orthology
K03259  
translation initiation factor 4E
Organism
dse  Drosophila sechellia
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dse00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dsec_GM13832
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dsec_GM13832
Messenger RNA biogenesis [BR:dse03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dsec_GM13832
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dsec_GM13832
Translation factors [BR:dse03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dsec_GM13832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 229 aa AA seqDB search
MLTTQQTEFKMMDNGTETLADSPSSSSEDLKALSEMDIRKPLTEIVDLRLKHPLENTWTL
WYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDP
ANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWT
ANGHNELAVMEIGLKLRDLLVLPPHQLQYQLHKDTMCKQGSVIKAVYCV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgacccagcagaccgaattcaagatgatggacaacggcaccgagacgctggcc
gattctccttcgagttccagtgaggacctgaaagcactttcggagatggatattcgcaag
cccctaacggagattgttgacttgcgccttaagcatccgctagagaacacttggacccta
tggtacctggagaatgatcgcagcaagaactgggaggacatgcagaacgagatcactagc
ttcgacatggtcgaggacttctggagtctctacaatcacattaagcaaccatctgagatt
agagtgggcagcgattattctttgttcaagaagggcattcagccaatgtgggaggatcct
gcaaacaagttcggcggccgttgggtcatcaatatggggcgtggctccaaagcggagctc
gacaagctttggctagatgtgctactcatactgattggcgaggcctttgaaaacaccgaa
gaagtctgcggcgctgttatcaacttgcgcgggaagagcaacaaaatttcgatttggacc
gccaacggacacaacgagctggccgtcatggagattggactcaagttacgcgacctgctc
gtcctgccgccccaccaactgcagtaccagctgcacaaggacactatgtgcaagcaggga
tcggtgatcaaagcggtttattgcgtgtaa

DBGET integrated database retrieval system